Recombinant Cyprinus carpio Mitochondrial uncoupling protein 2 (ucp2)

Shipped with Ice Packs
In Stock

Description

Sequence and Domains

  • Amino Acid Sequence: The full-length protein spans residues 1–310, with six transmembrane domains and conserved proton carrier signatures characteristic of the uncoupling protein family .

  • Post-Translational Modifications: Expressed in Escherichia coli, the protein lacks eukaryotic post-translational modifications unless specified .

Expression Systems

  • Host Organism: Primarily produced in E. coli for high-yield, cost-effective expression .

  • Tag Systems: Includes His-tag or GST-tag variants for simplified purification via affinity chromatography .

Quality Control

  • Purity: >95% as confirmed by SDS-PAGE and Western blot .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

ParameterDetails
Expression HostEscherichia coli (BL21 or similar strains)
TagHis-tag, GST-tag, or Strep-tag
Purity>95% (SDS-PAGE, HPLC)
ApplicationsWestern blotting, ELISA, immunoprecipitation, mitochondrial transport assays

Mechanistic Role

UCP2 regulates mitochondrial proton gradient dissipation, which impacts:

  • ATP Synthesis: Reduces ATP yield by uncoupling oxidative phosphorylation .

  • Reactive Oxygen Species (ROS): Attenuates ROS production by lowering mitochondrial membrane potential .

  • Metabolite Transport: Facilitates malate, oxaloacetate, and aspartate exchange for cytosolic phosphate, linking it to glutaminolysis and glucose oxidation .

Key Findings from Studies

  • Metabolic Reprogramming: UCP2 overexpression shifts cancer cells from glycolysis to oxidative phosphorylation, reducing tumor proliferation .

  • Antioxidant Role: Silencing UCP2 in hepatoma cells increases ROS and disrupts glutathione homeostasis .

Disease Models

  • Diabetes: UCP2 modulates insulin secretion in pancreatic β-cells by altering ATP/ADP ratios .

  • Neurodegeneration: Protects against ischemic brain injury by reducing mitochondrial ROS .

  • Cancer: Overexpressed in tumors to enhance glutamine metabolism and support rapid biomass synthesis .

Techniques Enabled by Recombinant UCP2

  • ELISA: Quantifies UCP2 expression in tissue lysates or serum samples .

  • Proteoliposome Assays: Measures malate/aspartate transport kinetics to study substrate specificity .

Comparative Analysis with Other UCP2 Orthologs

SpeciesSequence SimilarityKey Functional Difference
Homo sapiens78%Stronger association with insulin secretion disorders
Mus musculus76%Role in thermogenesis more pronounced
Danio rerio (Zebrafish)83%Enhanced ROS scavenging in hypoxic conditions

Future Directions

  • Therapeutic Targeting: Small-molecule activators/inhibitors of UCP2 could treat metabolic syndromes or cancer .

  • Structural Studies: Cryo-EM or NMR to resolve transport mechanisms unique to Cyprinus carpio UCP2 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage condition, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ucp2; slc25a8; Mitochondrial uncoupling protein 2; UCP 2; Solute carrier family 25 member 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Cyprinus carpio (Common carp)
Target Names
Target Protein Sequence
MVGFRAGDVPPTATVKFIGAGTAACIADLFTFPLDTAKVRLQIQGESKIPVNTGHGPVKY RGVFGTISTMVRVEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSR LMAGCTTGAMAVALAQPTDVVKVRFQAQNSAGANKRYHGTMDAYRTIAKEEGFRGLWKGT GPNITRNAIVNCTELVTYDLIKDALLKSSLMTDDLPCHFTSAFGAGFCTTVIASPVDVVK TRYMNSAPGQYCSALNCAVAMLTKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRAMM AARHNWATPL
Uniprot No.

Target Background

Function
Uncoupling proteins (UCPs) are mitochondrial transporter proteins that facilitate proton leakage across the inner mitochondrial membrane, thereby uncoupling oxidative phosphorylation from ATP synthesis. Consequently, energy is dissipated as heat.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of UCP2 in Cyprinus carpio, and how does it compare to UCP2 in other species?

UCP2 in Cyprinus carpio (common carp) belongs to the superfamily of mitochondrial anion carriers that dissociate the respiratory chain from ATP synthesis. Like other vertebrate UCP2 proteins, it contains six transmembrane domains and three proton carrier signatures that define the triplicate structure characteristic of mitochondrial uncoupling proteins . The protein also contains a purine-binding domain involved in controlling coupling efficiency.

Based on comparative studies with other fish species, Cyprinus carpio UCP2 likely shares approximately 83% amino acid similarity with zebrafish UCP2 and around 78% similarity with human, rat, and mouse UCP2 proteins . While specific information on Cyprinus carpio UCP2 is still emerging, studies on rainbow trout have shown that fish may possess multiple UCP2 isoforms (UCP2A and UCP2B), which typically differ only by minor amino acid substitutions in the transmembrane domains .

What are the primary physiological roles of UCP2 in Cyprinus carpio?

In Cyprinus carpio, UCP2 likely serves several important physiological functions similar to those observed in other vertebrates:

  • Regulation of reactive oxygen species (ROS): UCP2 attenuates steady-state levels of ROS by dissipating mitochondrial protonmotive force, thereby reducing mitochondrial membrane potential and subsequently decreasing electron leakage to oxygen .

  • Energy expenditure and metabolism: UCP2 is involved in regulating energy expenditure, body weight control, and fatty acid metabolism .

  • Protective functions: UCP2 likely provides protection against oxidative stress by reducing ROS production, which may be particularly important during periods of metabolic stress or environmental changes that fish commonly experience .

  • Cellular survival: Based on findings in mammals, UCP2 may promote cellular survival by preventing excessive calcium influx into mitochondria and reducing membrane potential, thereby protecting against cell death pathways .

Unlike UCP1, which primarily mediates adaptive thermogenesis, UCP2 in fish like Cyprinus carpio is not primarily involved in whole-body thermogenesis but rather plays roles in cellular protection and metabolic regulation .

What are the optimal methods for cloning and expressing recombinant Cyprinus carpio UCP2?

For cloning and expressing recombinant Cyprinus carpio UCP2, researchers should consider the following methodological approach:

  • RNA extraction and cDNA synthesis:

    • Extract total RNA from tissues with high UCP2 expression (likely gills, liver, or brain in Cyprinus carpio)

    • Synthesize cDNA using reverse transcription with oligo(dT) primers

    • Amplify UCP2 cDNA using PCR with primers designed based on conserved regions of UCP2 sequences from related fish species

  • Cloning strategy:

    • Insert the amplified UCP2 cDNA into an appropriate expression vector containing a promoter suitable for the chosen expression system

    • For bacterial expression, consider vectors with a His-tag or GST-tag to facilitate purification

    • Verify the cloned sequence through DNA sequencing

  • Expression systems (with comparative advantages):

Expression SystemAdvantagesDisadvantagesYieldRecommended For
E. coliHigh yield, economical, rapidMay lack proper folding for membrane proteins>95% purity possible Initial characterization, antibody production
Yeast (S. cerevisiae)Better folding for eukaryotic proteins, post-translational modificationsLower yield than bacteriaModerateFunctional studies, as demonstrated with human UCP2 mutations
Mammalian cells (HEK-293)Proper folding and post-translational modificationsHigher cost, technical complexity>90% purity Detailed functional studies
Cell-free protein synthesisAvoids toxicity issues, rapidCost, lower yield70-80% purity Difficult-to-express variants
  • Verification of expression:

    • Western blot analysis using antibodies against UCP2 or against the fusion tag

    • Verification of mitochondrial targeting in eukaryotic expression systems

What tissue sources are optimal for isolating and studying native Cyprinus carpio UCP2?

When studying native UCP2 in Cyprinus carpio, the choice of tissue is critical for successful isolation and characterization:

  • Recommended primary tissue sources:

    • Gills: Likely to express high levels of UCP2 based on studies in other fish species

    • Liver: Important metabolic tissue with significant UCP2 expression

    • Brain: Shown to express UCP2 in many vertebrates

    • White muscle: May express UCP2, especially during periods of metabolic adaptation

  • Tissue collection and processing protocol:

    • Harvest tissues from healthy specimens with minimal stress

    • Flash-freeze samples in liquid nitrogen immediately after collection

    • Store at -80°C for RNA or protein extraction

    • For mitochondrial isolation, process fresh tissues immediately

  • Extraction considerations:

    • Use specialized mitochondrial isolation buffers containing sucrose, EGTA, and protease inhibitors

    • Implement gentle homogenization techniques to preserve mitochondrial integrity

    • Consider density gradient centrifugation for higher purity mitochondrial fractions

  • Verification of tissue-specific expression:

    • Perform quantitative PCR to compare UCP2 expression levels across different tissues

    • Use western blotting with UCP2-specific antibodies to confirm protein expression

    • Consider immunohistochemistry to localize UCP2 within tissue structures

What are the most reliable methods for assessing the uncoupling activity of recombinant Cyprinus carpio UCP2?

The functional characterization of recombinant Cyprinus carpio UCP2 requires specialized techniques to accurately measure its uncoupling activity:

  • Mitochondrial membrane potential measurements:

    • Fluorescent probe method: Use voltage-sensitive dyes such as TMRM, JC-1, or Rhodamine 123 to monitor changes in membrane potential

    • Protocol: Isolate mitochondria from cells expressing recombinant UCP2, incubate with the fluorescent probe, and measure fluorescence changes upon addition of activators/inhibitors

    • Analysis: Decreased fluorescence indicates uncoupling activity

  • Oxygen consumption measurements:

    • High-resolution respirometry: Measure oxygen consumption rates using instruments like Oroboros Oxygraph or Seahorse XF Analyzer

    • Protocol: Compare state 4 (non-phosphorylating) respiration rates between mitochondria with and without recombinant UCP2 expression

    • Analysis: Increased state 4 respiration with unchanged state 3 (phosphorylating) respiration indicates uncoupling activity

  • Reconstitution in liposomes:

    • Proteoliposome preparation: Purify recombinant UCP2 and incorporate into artificial phospholipid vesicles

    • Ion transport assays: Measure proton transport using pH-sensitive fluorescent dyes or ion-selective electrodes

    • Analysis: Compare transport rates with positive controls (such as UCP1) and in the presence of known activators/inhibitors

  • Yeast or bacterial expression systems:

    • Growth characteristics: Monitor growth of UCP2-expressing yeast under conditions where mitochondrial uncoupling affects growth rate

    • Measurement of mitochondrial parameters: Isolate spheroplasts from yeast expressing UCP2 to assess functional parameters

    • Analysis: Compare with wild-type UCP2 and known UCP2 mutants

How can researchers effectively study the regulation of Cyprinus carpio UCP2 by activators and inhibitors?

Understanding the regulation of Cyprinus carpio UCP2 requires systematic approaches to test various modulators:

  • Experimental design for testing putative regulators:

Regulator TypeExamplesTest SystemMeasurement MethodExpected Outcome
ActivatorsSuperoxide, 4-hydroxynonenal, fatty acidsIsolated mitochondria, proteoliposomesMembrane potential, oxygen consumptionDecreased membrane potential, increased oxygen consumption
InhibitorsPurine nucleotides (GDP, ATP), carboxyatractylateIsolated mitochondria, proteoliposomesMembrane potential, oxygen consumptionIncreased membrane potential, decreased oxygen consumption
Physiological conditionspH changes, calcium levelsReconstituted systems, cellular modelsIon flux, membrane potentialVariable based on specific condition
  • Methodological approach:

    • Perform dose-response experiments to determine EC50 or IC50 values for each modulator

    • Compare effects across different experimental systems (isolated mitochondria, proteoliposomes, intact cells)

    • Validate with site-directed mutagenesis of key regulatory amino acid residues

    • Use competition assays to determine binding mechanisms

  • Advanced regulatory investigation:

    • Develop fish-specific cellular models by expressing Cyprinus carpio UCP2 in fish cell lines

    • Create adenoviral expression systems similar to those used for human UCP2 studies

    • Investigate post-translational modifications that may regulate UCP2 activity

How do researchers identify and characterize UCP2 gene variants in Cyprinus carpio populations?

The identification and characterization of UCP2 gene variants in Cyprinus carpio populations require comprehensive genetic analysis approaches:

  • Genomic DNA extraction and PCR:

    • Extract genomic DNA from blood, fin clips, or other tissues

    • Design primers targeting exon-intron boundaries of the UCP2 gene (similar to the approach used in )

    • Amplify UCP2 coding regions and regulatory elements

  • Variant detection methods:

    • DHPLC (Denaturing High-Performance Liquid Chromatography): Effective for screening variants as demonstrated in UCP2 studies

    • Next-generation sequencing: For comprehensive variant identification

    • RFLP (Restriction Fragment Length Polymorphism): For targeted known variant detection

  • Variant characterization workflow:

    • Sequence confirmation of identified variants

    • Bioinformatic analysis for predicted functional impacts

    • Population frequency determination

    • Phylogenetic analysis comparing to UCP2 sequences from other fish species

  • Functional impact assessment:

    • Recombinant expression of variant proteins

    • Comparative functional assays (as outlined in section 3.1)

    • Structural modeling to predict effects on protein conformation

What approaches are most effective for studying the evolution of UCP2 in Cyprinus carpio relative to other fish species and vertebrates?

Studying UCP2 evolution in Cyprinus carpio requires integrative approaches comparing across species:

  • Phylogenetic analysis methodology:

    • Collect UCP2 sequences from diverse fish species and other vertebrates

    • Perform multiple sequence alignment using tools like MUSCLE or CLUSTAL

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Estimate divergence times and evolutionary rates

  • Comparative genomic analysis:

    • Compare gene structure (exon-intron organization) across species

    • Analyze conservation of regulatory elements in promoter regions

    • Identify conserved transcription factor binding sites as demonstrated in rainbow trout UCP2 studies

    • Examine synteny (conservation of gene order) around the UCP2 locus

  • Selective pressure analysis:

    • Calculate dN/dS ratios to identify signatures of positive, negative, or neutral selection

    • Perform site-specific selection analysis to identify amino acid positions under selection

    • Compare selection patterns across different protein domains

  • Gene duplication and divergence:

    • Investigate potential UCP2 gene duplications in cyprinid fishes

    • Compare potential paralogs (e.g., UCP2A and UCP2B) as identified in rainbow trout

    • Analyze functional divergence between duplicate genes

How can researchers effectively use recombinant Cyprinus carpio UCP2 to study the protein's role in oxidative stress protection?

Investigating UCP2's role in oxidative stress protection requires specialized approaches:

  • Cellular models for oxidative stress studies:

    • Transfection approaches: Express Cyprinus carpio UCP2 in fish cell lines using vectors with fluorescent markers for tracking

    • Adenoviral expression systems: Develop systems similar to those used for human UCP2

    • CRISPR/Cas9 gene editing: Create UCP2 knockout or knockin fish cell lines

  • Oxidative stress induction protocols:

    • Chemical inducers: Hydrogen peroxide, tert-butyl hydroperoxide, paraquat

    • Physical stressors: Hypoxia/reoxygenation, temperature stress

    • Physiological stressors: Lipid overload, high glucose conditions

  • ROS measurement techniques:

    • Fluorescent probes: DCFDA, MitoSOX, DHE

    • EPR spectroscopy: For direct superoxide measurement

    • Protein oxidation markers: Protein carbonylation, lipid peroxidation products

  • Experimental design for testing UCP2 protective effects:

Experimental GroupUCP2 StatusStress ConditionMeasurementsExpected Outcome
ControlEndogenous expressionNo stressBaseline ROS, mitochondrial membrane potentialReference levels
Stress onlyEndogenous expressionOxidative stress inductionROS levels, cell viability, mitochondrial functionIncreased ROS, decreased viability
UCP2 overexpressionRecombinant expressionOxidative stress inductionROS levels, cell viability, mitochondrial functionAttenuated ROS increase, improved viability
UCP2 inhibitionInhibited/silencedOxidative stress inductionROS levels, cell viability, mitochondrial functionEnhanced ROS production, decreased viability

What methodologies allow researchers to investigate the interaction between Cyprinus carpio UCP2 and other mitochondrial proteins?

Understanding protein-protein interactions involving UCP2 requires specialized techniques:

  • Co-immunoprecipitation approaches:

    • Use antibodies against UCP2 or epitope tags to pull down protein complexes

    • Identify interacting partners by mass spectrometry

    • Validate interactions with reverse co-immunoprecipitation and western blotting

  • Proximity labeling methods:

    • BioID: Fuse UCP2 with a biotin ligase to biotinylate proteins in close proximity

    • APEX2: Use an engineered peroxidase to tag neighboring proteins

    • Analysis: Purify biotinylated proteins and identify by mass spectrometry

  • Protein crosslinking strategies:

    • Use chemical crosslinkers of various arm lengths to capture transient interactions

    • Apply photo-activatable crosslinkers for precise spatial control

    • Analyze crosslinked complexes by SDS-PAGE and mass spectrometry

  • Fluorescence-based interaction studies:

    • FRET (Förster Resonance Energy Transfer): Tag UCP2 and potential partners with fluorescent proteins

    • BiFC (Bimolecular Fluorescence Complementation): Split fluorescent protein complementation assays

    • Imaging: Visualize interactions in living cells using confocal microscopy

What are the most common issues in recombinant expression of Cyprinus carpio UCP2 and how can they be resolved?

Researchers face several challenges when expressing recombinant Cyprinus carpio UCP2:

  • Low expression levels:

    • Problem: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Optimize codon usage for the expression system

      • Use expression vectors with strong promoters

      • Try fusion tags that enhance solubility (MBP, SUMO)

      • Lower expression temperature (16-20°C)

      • Consider specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane proteins

  • Protein misfolding and aggregation:

    • Problem: Improper folding leading to inclusion body formation

    • Solutions:

      • Express in eukaryotic systems like yeast that better handle membrane proteins

      • Add specific lipids during expression/purification

      • Use mild detergents for extraction (DDM, LDAO)

      • Try cell-free expression systems with lipid nanodiscs

  • Toxicity to host cells:

    • Problem: UCP2 expression may disrupt host cell mitochondrial function

    • Solutions:

      • Use tightly controlled inducible expression systems

      • Reduce induction time and strength

      • Consider cell-free protein synthesis systems

  • Poor functional activity:

    • Problem: Recombinant protein lacks proper activity

    • Solutions:

      • Ensure correct lipid environment during purification

      • Add cardiolipin during reconstitution

      • Verify protein orientation in proteoliposomes

      • Test multiple purification conditions to maintain native structure

How can researchers address data interpretation challenges when comparing Cyprinus carpio UCP2 function with UCP2 from other species?

When comparing UCP2 function across species, researchers encounter several interpretation challenges:

  • Physiological context differences:

    • Challenge: Temperature optima differ between fish and mammals

    • Solution: Perform experiments at species-relevant temperatures

    • Analysis approach: Create temperature-activity profiles for both species' proteins

  • Evolutionary divergence effects:

    • Challenge: Functional divergence due to adaptation to different environments

    • Solution: Create chimeric proteins swapping domains between species

    • Analysis approach: Identify which protein domains contribute to species-specific functions

  • Experimental system limitations:

    • Challenge: Heterologous systems may not represent native environments

    • Solution: Develop fish cell lines for more relevant expression contexts

    • Analysis approach: Compare results across multiple experimental systems

  • Regulatory mechanism differences:

    • Challenge: Different activators/inhibitors may exist across species

    • Solution: Test broad panels of potential regulators specific to each species

    • Analysis approach: Create comparative regulatory profiles and identify conserved versus divergent mechanisms

What emerging technologies could advance our understanding of Cyprinus carpio UCP2 structure and function?

Several cutting-edge technologies show promise for advancing UCP2 research:

  • Cryo-electron microscopy (Cryo-EM):

    • Application: Determine high-resolution structures of UCP2 in native-like lipid environments

    • Advantage: Requires less protein than crystallography and preserves protein in a more native state

    • Challenge: Optimization for membrane proteins of UCP2's size (~33 kDa)

  • AlphaFold and deep learning structure prediction:

    • Application: Generate accurate structural models of Cyprinus carpio UCP2 and its variants

    • Advantage: Can predict structures without experimental determination

    • Integration: Combine with molecular dynamics to understand conformational changes

  • Single-molecule techniques:

    • Application: Observe UCP2 function at the individual protein level

    • Methods: Single-molecule FRET, high-speed AFM, nanopore recording

    • Insight potential: Reveal transient states and heterogeneity in function

  • Organoid and tissue-on-chip technologies:

    • Application: Study UCP2 function in more complex multicellular environments

    • Advantage: Better recapitulates in vivo conditions than cell culture

    • Potential: Integrate with real-time imaging of mitochondrial function

How might understanding Cyprinus carpio UCP2 inform broader research questions in comparative physiology and evolution?

Research on Cyprinus carpio UCP2 has implications for several broader research areas:

  • Environmental adaptation mechanisms:

    • Research question: How does UCP2 function adapt to different temperature regimes?

    • Approach: Compare UCP2 from fish species adapted to different thermal environments

    • Significance: Insight into molecular adaptations to climate change

  • Metabolic regulation across vertebrates:

    • Research question: Are UCP2's roles in metabolic regulation conserved across vertebrate evolution?

    • Approach: Systematic comparative studies across fish, amphibians, reptiles, birds, and mammals

    • Significance: Understanding fundamental principles of metabolic control

  • Convergent evolution of mitochondrial uncoupling:

    • Research question: Have similar UCP2 functions evolved independently in different lineages?

    • Approach: Compare UCP2 regulation and function across distantly related species

    • Significance: Insight into evolutionary constraints on mitochondrial function

  • Translational aspects to aquaculture:

    • Research question: Does UCP2 function affect growth efficiency and stress resistance in farmed fish?

    • Approach: Correlate UCP2 variants with production traits and disease resistance

    • Significance: Potential genetic markers for selective breeding programs

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.