Recombinant Cyprinus carpio NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cyprinus carpio NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) represents a critical component of the mitochondrial respiratory chain in Cyprinus carpio, commonly known as the common carp. This protein is encoded by the mitochondrial genome and functions as an integral subunit of Complex I in the electron transport chain. The "MT" prefix indicates its mitochondrial origin, while "ND3" designates it as NADH dehydrogenase subunit 3 . As a mitochondrially encoded protein, MT-ND3 is synthesized within the mitochondria based on information contained in the mitochondrial DNA.

The term "recombinant" refers to the artificially produced form of this protein, created through genetic engineering techniques. This recombinant production enables researchers to obtain purified samples of MT-ND3 for detailed study, facilitating investigations into its structure, function, and potential applications. Commercial suppliers such as CUSABIO TECHNOLOGY LLC provide recombinant Cyprinus carpio MT-ND3 for research purposes .

Cyprinus carpio represents an important species in aquaculture and ecological research. Found widely across various regions, including subspecies such as rice flower carp (Cyprinus carpio rubrofuscus) in South China, this species has significant economic value in fisheries and fish farming . Understanding its respiratory components, particularly MT-ND3, contributes valuable insights to both fundamental biology and applied aquaculture science.

Genetic Structure and Organization

The MT-ND3 gene in Cyprinus carpio is located within the mitochondrial genome, which in closely related subspecies like Cyprinus carpio rubrofuscus spans approximately 16,582 base pairs . This mitochondrial genome contains 13 protein-coding genes (including MT-ND3), 22 transfer RNA genes, and two ribosomal RNA genes . Within this genomic organization, MT-ND3 represents one of the essential components of the respiratory apparatus.

Analysis of the mitochondrial genome in Cyprinus carpio rubrofuscus reveals specific nucleotide composition patterns that likely affect MT-ND3 structure and function. The complete mitochondrial genome shows base distributions of A (31.89%), T (24.82%), C (27.53%), and G (15.76%), with a relatively high C+G content of 43.29% . This composition influences protein coding patterns and may impact the structural stability of the resulting MT-ND3 protein.

Unlike most mitochondrial genes encoded on the heavy strand, MT-ND3 is one of nine genes encoded by the light strand of mitochondrial DNA in Cyprinus carpio . This positioning within the genome reflects its evolutionary history and functional significance. In Cyprinus carpio rubrofuscus, MT-ND3 utilizes a TAG stop codon, which differs from some other mitochondrial protein-coding genes that employ TAA stop codons or incomplete T- stop codons .

Protein Structure and Composition

Based on comparative analysis with homologous proteins, Cyprinus carpio MT-ND3 likely produces a protein of approximately 13 kDa, similar to its human counterpart . The MT-ND3 protein represents one of the most hydrophobic components of Complex I, contributing to the core of the transmembrane region . This hydrophobicity facilitates its integration into the inner mitochondrial membrane, where it participates in the proton pumping mechanism essential for ATP synthesis.

The following table summarizes the key structural characteristics of MT-ND3 based on available research:

CharacteristicDescription
Approximate Molecular Weight13 kDa (based on homology with human MT-ND3)
Estimated Amino Acid LengthApproximately 115 amino acids (inferred from human MT-ND3)
Structural NatureHighly hydrophobic transmembrane protein
Location in Complex ICore of the transmembrane domain
Coding StrandLight strand of mitochondrial DNA
Stop CodonTAG

Role in Complex I

MT-ND3 serves as an integral component of NADH:ubiquinone oxidoreductase (Complex I), the first and largest enzyme complex in the mitochondrial electron transport chain. Complex I catalyzes the transfer of electrons from NADH to ubiquinone, coupled with the translocation of protons across the inner mitochondrial membrane . This process represents the initial step in oxidative phosphorylation, the primary mechanism of cellular energy production.

Within Complex I, MT-ND3 forms part of the core subunits that constitute the membrane-embedded domain. This domain contains the machinery responsible for proton translocation, a critical process in energy transduction . While the precise contribution of MT-ND3 to the catalytic function of Complex I remains incompletely characterized, its evolutionary conservation across species underscores its functional importance.

Electron microscopy studies of NADH:ubiquinone oxidoreductase reveal the L-shaped structure of Complex I, with variations in structure potentially affecting functional elements like the ubiquinone-binding site . As part of this complex architectural arrangement, MT-ND3 contributes to maintaining the structural integrity necessary for efficient electron transfer and proton pumping activities.

Electron Transport and Energy Production

The electron transport chain, in which MT-ND3-containing Complex I participates, represents the culmination of cellular respiration, where the energy of nutrients is converted to ATP. The process begins with Complex I accepting electrons from NADH and transferring them to ubiquinone (Coenzyme Q). This electron transfer drives the pumping of protons from the mitochondrial matrix to the intermembrane space, contributing to the electrochemical gradient that powers ATP synthesis.

Proteomic analyses have identified various components of the respiratory chain that may interact with or complement MT-ND3 function. Differentially expressed proteins in Cyprinus carpio include several related to mitochondrial energy metabolism, such as:

ProteinFunctionFold ChangeSignificance (p-value)
NDUFA10NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 101.640.0027091
NDUFS4NADH dehydrogenase [ubiquinone] iron-sulfur protein 41.610.00001724
ATP5F1ATP synthase F(0) complex subunit B11.690.0064455
Cytochrome b-c1 complex subunit RieskeComponent of respiratory Complex III1.700.0031496

These proteins, along with MT-ND3, form part of the interconnected network of components that facilitate cellular energy production in Cyprinus carpio.

Comparative Analysis Across Species

In humans, MT-ND3 is located in the mitochondrial genome from base pair 10,059 to 10,404 and produces a 13 kDa protein composed of 115 amino acids . Variants of human MT-ND3 are associated with several mitochondrial diseases, including Mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS), Leigh's syndrome (LS), and Leber's hereditary optic neuropathy (LHON) .

Phylogenetic analysis reveals that Cyprinus carpio and its subspecies cluster together based on mitochondrial genome sequences, including protein-coding genes like MT-ND3 . This clustering reflects the evolutionary relationships among these closely related taxa and provides a framework for understanding the evolution of mitochondrial proteins in this lineage.

An interesting feature observed in some species, though not specifically reported for Cyprinus carpio, is the presence of an untranslated extra nucleotide in the MT-ND3 gene of many bird and turtle species . This feature requires mechanisms such as translational frameshifting or RNA editing to maintain gene functionality, highlighting the evolutionary flexibility of mitochondrial genes across diverse taxonomic groups.

Applications in Molecular Biology and Biochemistry

Recombinant Cyprinus carpio MT-ND3 provides an important tool for investigating mitochondrial function in fish species. The availability of purified recombinant protein enables detailed structural analyses through techniques such as X-ray crystallography or cryo-electron microscopy, potentially revealing species-specific adaptations in this critical respiratory component.

Functional studies using recombinant MT-ND3 can elucidate its specific role within Complex I, including its interactions with other subunits and contribution to electron transfer and proton pumping activities. Such studies may employ reconstituted systems, where the protein is incorporated into artificial membrane environments to study its functional properties under controlled conditions.

Comparative biochemical analyses between Cyprinus carpio MT-ND3 and its counterparts in other species can provide insights into the evolution of the respiratory chain and mechanisms of adaptation to different environmental conditions. These comparisons may reveal functional adaptations that contribute to the success of Cyprinus carpio in diverse aquatic habitats.

Relevance to Aquaculture and Fisheries

Genetic variation in MT-ND3 and other respiratory components may contribute to differences in performance traits among different strains or populations of Cyprinus carpio. Identifying such variations could inform selective breeding programs aimed at enhancing desirable traits such as growth rate, disease resistance, or environmental adaptation.

Environmental stressors such as temperature extremes, hypoxia, or pollutants may affect the function of respiratory chain components including MT-ND3. Studies using recombinant MT-ND3 can help elucidate mechanisms of stress response and adaptation, potentially informing management practices in both aquaculture and conservation contexts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Cyprinus carpio (Common carp)
Target Names
Target Protein Sequence
MNLIMTILTITVALSLILATVSFWLPQMNPDAEKLSPYECGFDPLGSARLPFSLRFFLVA ILFLLFDLEIALLLPLPWGDQLHNPTGTFFWATTVLILLTLGLIYEWTQGGLEWAE
Uniprot No.

Target Background

Function

Recombinant Cyprinus carpio NADH-ubiquinone oxidoreductase chain 3 (MT-ND3): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links

KEGG: ccar:807771

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (MT-ND3) in common carp?

MT-ND3 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) in common carp (Cyprinus carpio). This protein is believed to belong to the minimal assembly required for catalysis in the electron transport chain. Complex I functions in transferring electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor for the enzyme . The MT-ND3 gene is encoded in the mitochondrial genome and produces a hydrophobic membrane protein that forms part of the proton-translocating component of Complex I.

How does MT-ND3 contribute to electron transport and energy production?

MT-ND3 is an essential component of Complex I (NADH:ubiquinone oxidoreductase), which catalyzes the first step in the mitochondrial electron transport chain. This complex transfers electrons from NADH to ubiquinone, coupled with proton translocation across the inner mitochondrial membrane .

The specific role of MT-ND3 includes:

  • Contributing to the formation of the membrane domain of Complex I

  • Participating in proton translocation across the membrane

  • Maintaining the structural integrity of the complex

  • Potentially participating in ubiquinone binding

MT-ND3's function is critical for ATP production through oxidative phosphorylation, making it essential for cellular energy metabolism in common carp.

How can MT-ND3 be used for genetic diversity studies in common carp populations?

MT-ND3 is frequently utilized alongside other mitochondrial genes for population genetic studies in common carp. Researchers typically analyze:

  • Single-nucleotide polymorphisms (SNPs) within the MT-ND3 gene

  • Haplotype diversity across populations

  • Nucleotide diversity (π) as a measure of genetic variation

Mitochondrial markers like MT-ND3 can reveal maternal lineage patterns and population structure. Studies have shown that analysis of mitochondrial genes can identify distinct genetic clusters in carp populations. For example, research on common carp populations from the Pearl River and Nandujiang River found significant genetic differentiation (Fst values ranging from 0.05 to 0.25) .

What genetic variation has been observed in MT-ND3 across different carp populations?

Genetic variation in mitochondrial genes, including MT-ND3, has been widely documented across common carp populations. Studies have shown:

  • Variable haplotype diversity ranging from 0.065 (in isolated strains) to 0.867 (in wild populations)

  • Nucleotide diversity (π) ranging from 0.0004 to 0.0093 depending on the population

  • Different numbers of haplotypes detected across populations

For example, research on the common carp black strain population found significantly lower genetic variation compared to other populations, with haplotype diversity of only 0.065±0.010776 and nucleotide diversity of 0.0004±0.000072 . This indicates potential genetic bottlenecks or founder effects in cultivated strains.

How does MT-ND3 compare to other mitochondrial markers for population genetics?

While MT-ND3 is valuable for population genetics, studies typically use it in combination with other mitochondrial markers:

Mitochondrial MarkerAdvantagesLimitationsTypical Applications
MT-ND3/4Moderate variation, well-suited for population differentiationLess variable than D-loopPopulation structure, phylogenetics
MT-ND5/6Good for detecting deeper evolutionary relationshipsModerate mutation ratePhylogeography, species identification
Cytochrome b (Cytb)Well-conserved, extensive reference dataLower resolution for recent divergenceSpecies identification, phylogenetics
D-loop (Control Region)Highest variability, detects recent population changesHigh homoplasyPopulation genetics, recent divergence

Research has shown that the combination of multiple mitochondrial markers provides more comprehensive insights. For instance, studies combining MT-ND3/4 and MT-ND5/6 identified 13 and 9 different haplotypes respectively in common carp populations from the southern Caspian Sea .

What are the recommended protocols for MT-ND3 gene amplification from carp samples?

For amplification of MT-ND3 from common carp samples, the following protocol is recommended:

  • DNA Extraction:

    • Extract total DNA from fin clips or muscle tissue using standard phenol-chloroform extraction or commercial kits

    • Ensure DNA quality with A260/A280 ratio between 1.8-2.0

  • PCR Amplification:

    • Use primers targeting conserved regions flanking MT-ND3

    • Forward primer: 5'-CTACTAGGCCTCCTCCTAGC-3'

    • Reverse primer: 5'-GAGGAGGTTAGGATTACGAG-3'

    • PCR conditions: Initial denaturation at 94°C for 5 min; 35 cycles of 94°C for 45 s, 55°C for 45 s, 72°C for 60 s; final extension at 72°C for 10 min

  • Verification:

    • Verify amplification on 1.5% agarose gel (expected product size: ~350 bp)

    • Purify PCR products using silica-based purification methods

The PCR-RFLP methodology has been effectively used for analyzing mitochondrial gene variations in common carp, with average haplotype diversity of 0.48 reported for ND-3/4 gene regions .

What expression systems are most effective for producing recombinant MT-ND3?

Due to the hydrophobic nature and membrane integration of MT-ND3, expression of functional recombinant protein presents significant challenges. Based on research with similar mitochondrial proteins:

  • Bacterial Expression Systems:

    • E. coli BL21(DE3) with specialized vectors containing solubility tags (MBP, SUMO, or TrxA)

    • Expression conditions: Induction with 0.5 mM IPTG at lower temperatures (16-18°C) for 18-24 hours

    • Challenge: Proper membrane integration and potential toxicity

  • Eukaryotic Expression Systems:

    • Insect cell lines (Sf9, High Five) using baculovirus expression system

    • Yeast systems (Pichia pastoris) with inducible promoters

    • Advantage: Better membrane protein processing and folding

  • Cell-Free Expression Systems:

    • Wheat germ or rabbit reticulocyte lysate systems with supplied membrane mimetics

    • Allows controlled incorporation into nanodiscs or liposomes

For proper folding and function, co-expression with other Complex I components may be necessary. Storage recommendations include using Tris-based buffer with 50% glycerol at -20°C, with working aliquots kept at 4°C for up to one week .

How can genetic variations in MT-ND3 be analyzed using PCR-RFLP?

PCR-RFLP is an effective method for analyzing genetic variations in MT-ND3:

  • PCR Amplification:

    • Amplify MT-ND3 region using specific primers as described in section 3.1

  • Restriction Enzyme Selection:

    • Analyze sequence for informative restriction sites

    • Commonly used enzymes for MT-ND3: HinfI, HaeIII, MboI, and AluI

    • In silico analysis to predict fragment patterns for known variants

  • Restriction Digestion:

    • Digest 5-10 μl of PCR product with appropriate restriction enzymes

    • Incubate at optimal temperature (typically 37°C) for 3-16 hours

  • Fragment Analysis:

    • Analyze digested products on 2-3% agarose gel or 8% polyacrylamide gel

    • Document with digital imaging systems

    • Compare fragment patterns to identify haplotypes

  • Data Analysis:

    • Calculate haplotype diversity and nucleotide diversity

    • Perform statistical analysis to determine population differentiation

Studies on common carp populations have successfully applied PCR-RFLP to mitochondrial genes, demonstrating average haplotype diversity of 0.48 for ND-3/4 gene regions . This approach has revealed significant genetic structuring among geographically separated populations.

How can MT-ND3 sequence data be used for phylogenetic analysis of carp populations?

MT-ND3 sequence data provides valuable insights for phylogenetic analysis of carp populations:

  • Sequence Alignment and Processing:

    • Align sequences using MUSCLE or CLUSTAL algorithms

    • Trim to ensure equal length and quality across samples

    • Identify informative sites for phylogenetic reconstruction

  • Phylogenetic Tree Construction:

    • Maximum Likelihood method using models like GTR+G+I

    • Bayesian Inference with MrBayes or BEAST

    • Distance-based methods (Neighbor-Joining) for initial analysis

  • Haplotype Network Analysis:

    • Construct using TCS or Network software

    • Visualize relationships between closely related haplotypes

    • Identify ancestral haplotypes and mutation patterns

  • Molecular Clock Analysis:

    • Calibrate using fossil records or geological events

    • Estimate divergence times between populations

    • Relate to historical environmental changes

Studies of common carp populations have revealed distinct phylogenetic clusters corresponding to subspecies, including C. c. rubrofuscus, C. c. haematopterus, and C. c. carpio, all occurring in both the Pearl River and Nandujiang River basins . Bayesian clustering analyses have detected that global populations consisted of eight genetic clusters, with some populations showing relatively pure genetic composition .

What are the challenges in studying MT-ND3 mutations and their functional impacts?

Investigating MT-ND3 mutations presents several methodological challenges:

  • Obtaining Mutant Variants:

    • Natural variants may be rare or have subtle phenotypes

    • Site-directed mutagenesis of recombinant proteins is complicated by membrane integration

    • CRISPR-based mitochondrial DNA editing remains technically challenging

  • Functional Assays:

    • Need for intact mitochondria or reconstituted membrane systems

    • Complex I activity measurements requiring specialized equipment

    • Difficulty isolating effects of single subunit modifications in large complexes

  • Structural Analysis:

    • Hydrophobic nature complicates crystallization

    • Requires advanced techniques like cryo-EM for structural determination

    • Interaction studies with other Complex I components are technically demanding

  • In vivo Studies:

    • Mitochondrial transformation in fish models is difficult

    • Cell culture systems may not reflect tissue-specific effects

    • Difficulty separating primary from secondary consequences of mutations

Researchers can address these challenges by utilizing cybrid cell lines, developing fish-specific mitochondrial targeting approaches, and employing advanced biophysical techniques like hydrogen-deuterium exchange mass spectrometry to study conformational changes.

How does genetic diversity in MT-ND3 correlate with environmental adaptation in carp?

Recent research suggests important connections between MT-ND3 genetic diversity and environmental adaptation:

  • Temperature Adaptation:

    • Specific MT-ND3 haplotypes show correlation with temperature ranges

    • Amino acid substitutions may affect protein stability at different temperatures

    • Population-specific variants correlate with thermal habitat preferences

  • Hypoxia Tolerance:

    • Variants in MT-ND3 may contribute to more efficient electron transport under low oxygen

    • Populations from hypoxic environments show distinct haplotype distributions

    • Potentially impacts ROS production during oxygen fluctuations

  • Metabolic Efficiency:

    • MT-ND3 variants potentially affect proton pumping efficiency

    • May contribute to differences in growth rates and energy utilization

    • Cultured strains often show reduced genetic diversity (h = 0.065) compared to wild populations (h up to 0.867)

  • Anthropogenic Pressures:

    • Human-mediated selection may drive changes in MT-ND3 frequency

    • Populations exposed to pollutants show evidence of selection at respiratory chain loci

    • Aquaculture practices may influence genetic diversity patterns

Studies have shown that common carp populations experienced historical expansion during 0.125–0.250 million years ago, potentially coinciding with climate changes that may have selected for specific mitochondrial variants . This temporal framework provides context for understanding current diversity patterns in MT-ND3.

What are promising new techniques for studying MT-ND3 function and structure?

Emerging technologies offer new opportunities for MT-ND3 research:

  • Cryo-EM Applications:

    • High-resolution structural determination of entire Complex I

    • Visualization of MT-ND3 in native membrane environment

    • Potential to capture different conformational states during catalysis

  • Single-Molecule Techniques:

    • FRET-based approaches to study conformational dynamics

    • Patch-clamp of reconstituted complexes to measure proton translocation

    • Atomic Force Microscopy for physical properties of membrane-embedded MT-ND3

  • Advanced Genetic Tools:

    • Mitochondria-targeted nucleases for precise genetic manipulation

    • Base editing technologies adapted for mitochondrial DNA

    • Barcoding approaches for tracking mitochondrial lineages in mixed populations

  • Computational Approaches:

    • Molecular dynamics simulations of MT-ND3 in lipid bilayers

    • Machine learning applications for predicting functional effects of variants

    • Systems biology approaches integrating transcriptomics and proteomics data

These technologies will enable researchers to address fundamental questions about MT-ND3's role in Complex I assembly, electron transport mechanism, and evolutionary adaptations in different carp populations.

How might MT-ND3 research contribute to conservation efforts for wild carp populations?

MT-ND3 research has significant potential applications for conservation:

  • Genetic Diversity Monitoring:

    • MT-ND3 sequencing as part of genetic diversity assessment protocols

    • Establishment of baseline haplotype distributions in protected populations

    • Monitoring changes in diversity over time in response to conservation efforts

  • Population Structure Delineation:

    • Using MT-ND3 and other markers to define conservation units

    • Identifying genetically distinct populations requiring specific protection

    • Detecting admixture between wild and cultured stocks

  • Selection Pressure Analysis:

    • Identifying signatures of selection in MT-ND3 related to environmental stressors

    • Understanding adaptive capacity in the face of climate change

    • Predicting vulnerability based on mitochondrial genetic diversity

  • Breeding Program Design:

    • Incorporating MT-ND3 haplotype information in broodstock selection

    • Maintaining mitochondrial genetic diversity in captive breeding programs

    • Avoiding inadvertent selection for specific haplotypes during domestication

Research has demonstrated that artificial fish propagation and release programs can impact the genetic structure of wild populations . By monitoring MT-ND3 and other genetic markers, conservation biologists can assess these impacts and develop more effective management strategies.

How does MT-ND3 from common carp compare to other species?

Comparative analysis of MT-ND3 across species provides evolutionary insights:

  • Sequence Conservation:

    • Core functional regions show high conservation across vertebrates

    • Transmembrane domains show higher conservation than loop regions

    • Species-specific variations often occur at similar positions

  • Cross-Species Comparison:

    • Common carp MT-ND3 shows ≈85-90% sequence identity with other cyprinids

    • ≈75-80% identity with other teleost fishes

    • ≈60-65% identity with mammalian homologs

  • Functional Divergence:

    • Species-specific substitutions may reflect metabolic adaptations

    • Temperature-dependent differences in conformational stability

    • Variations in proton-pumping efficiency related to ecological niches

  • Co-evolution Patterns:

    • Evidence for co-evolution with other Complex I subunits

    • Compensatory mutations maintaining structural integrity

    • Nuclear-mitochondrial co-adaptation patterns

Comparing MT-ND3 across different fish species and vertebrate lineages provides valuable insights into the evolution of mitochondrial function and can help identify functionally important residues and regions within this protein.

What can we learn from comparing different mitochondrial markers in common carp?

Comparative analysis of multiple mitochondrial markers reveals complementary information:

MarkerVariability in Common CarpEvolutionary RateBest Applications
MT-ND3ModerateModeratePopulation genetics, phylogeography
CytbVariable (h = 0.065-0.867)Slow-ModerateSpecies identification, deep phylogeny
D-loopHigh (h = 0.384-0.867)RapidRecent population changes, fine-scale structure
COILow-ModerateSlowDNA barcoding, species boundaries

Studies have shown:

  • Cytb and D-loop analyses revealed highest haplotype diversity in Heilongjiang carp (h = 0.867) and lowest in Common carp black strain (h = 0.065)

  • Different genes can detect different aspects of population history

  • Combined analysis provides more robust phylogenetic resolution

  • Temporal sensitivity varies among markers

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.