Recombinant Cyprinus carpio Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Functional Properties and Physiological Role

Rhodopsin serves as the primary photoreceptor molecule in rod cells, responsible for dim-light vision in vertebrates. Like other visual rhodopsins, the Cyprinus carpio variant likely functions through a similar phototransduction cascade.

Visual Transduction Mechanism

The functional cycle of rhodopsin begins with the absorption of a photon, which triggers isomerization of the bound 11-cis-retinal to all-trans-retinal . This conformational change induces a series of structural rearrangements in the protein, leading to the activation of the G protein transducin and initiating the visual signaling cascade .

The photocycle of rhodopsin proceeds through several intermediate states, with the key steps including:

  1. Light absorption by the dark state (ground state) rhodopsin

  2. Formation of bathorhodopsin (primary photoproduct)

  3. Sequential transitions through several spectroscopically distinct intermediates

  4. Formation of metarhodopsin II (the active signaling state)

  5. Hydrolysis of the Schiff base and release of all-trans-retinal

Spectral Properties

As a visual pigment, Cyprinus carpio rhodopsin exhibits spectral characteristics optimized for the aquatic environment. The spectral profile consists of a main absorbance band (α-band) in the visible region, a smaller β-band, and a γ-band in the near-UV region that primarily originates from the aromatic residues of the opsin protein .

The maximum absorption wavelength (λmax) of rhodopsins can be fine-tuned through specific amino acid substitutions, particularly those within 10 Å of the chromophore binding pocket. These spectral tuning mechanisms are crucial for adaptation to different light environments, such as marine versus freshwater habitats .

Evolutionary Adaptations

Studies on rhodopsin genes across various fish species have revealed evidence of adaptive evolution in response to different aquatic environments. For instance, transitions from marine to freshwater habitats can drive positive selection in rhodopsin genes, resulting in amino acid substitutions that optimize spectral sensitivity for specific light conditions .

While specific adaptations of Cyprinus carpio rhodopsin have not been extensively characterized, the carp's adaptation to diverse freshwater environments suggests possible spectral tuning mechanisms similar to those observed in other freshwater fishes.

Expression and Purification

Recombinant Cyprinus carpio rhodopsin is typically produced in Escherichia coli expression systems. The commercially available recombinant protein features an N-terminal His-tag to facilitate purification . The expression construct contains the full-length sequence (amino acids 1-354) of the rhodopsin protein .

Production ParameterSpecification
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull length (1-354)
FormLyophilized powder
Purity>90% (SDS-PAGE)

Functional Characterization

Functional characterization of recombinant rhodopsins often includes spectroscopic analysis to assess chromophore binding and photoactivation properties. Absorption spectroscopy can confirm proper protein folding and chromophore incorporation, while fluorescence spectroscopy is used to measure the kinetics of retinal release following photoactivation .

In comparative studies with other fish rhodopsins, measurements of retinal release kinetics provide valuable insights into functional adaptations. For instance, visual rhodopsins typically exhibit longer half-lives of retinal release compared to non-visual opsins, reflecting their specialized role in visual transduction .

Comparative and Evolutionary Studies

The rhodopsin gene family has become an important model for studying molecular evolution and adaptation. Recombinant Cyprinus carpio rhodopsin can be used in comparative analyses with other fish rhodopsins to investigate:

  1. Spectral tuning mechanisms in different aquatic environments

  2. Evolutionary patterns of selection pressure on visual pigment genes

  3. Functional consequences of amino acid substitutions

  4. Adaptation to various ecological niches

Recent research has demonstrated that rhodopsin genes can undergo positive selection during environmental transitions, such as shifts from marine to freshwater habitats . These evolutionary patterns provide insights into the molecular basis of visual adaptation across diverse aquatic environments.

Biotechnological Applications

Beyond basic research, rhodopsins have emerging applications in biotechnology fields such as optogenetics and protein engineering. While type-2 (animal) rhodopsins like Cyprinus carpio rhodopsin are less commonly used in these applications than microbial rhodopsins, they still offer valuable models for understanding GPCR structure and function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please specify it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing that tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Cyprinus carpio (Common carp)
Target Names
rho
Target Protein Sequence
MNGTEGPMFYVPMSNATGVVKSPYDYPQYYLVAPWAYGCLAAYMFFLIITGFPINFLTLY VTIEHKKLRTPLNYILLNLAISDLFMVFGGFTTTMYTSLHGYFVFGRIGCNLEGFFATLG GEMGLWSLVVLAFERWMVVCKPVSNFRFGENHAIMGVVFTWFMACTCAVPPLVGWSRYIP EGMQCSCGVDYYTRAPGYNNESFVIYMFLVHFIIPLIVIFFCYGRLVCTVKDAAAQQQES ETTQRAEREVTRMVVIMVIGFLICWIPYASVAWYIFTHQGSEFGPVFMTVPAFFAKSAAV YNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor, is essential for image-forming vision under low light conditions. While most marine fish species utilize retinal as a chromophore, most freshwater fish employ 3-dehydroretinal or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

Basic Research Questions

  • What is the molecular structure of Cyprinus carpio rhodopsin?

Cyprinus carpio (common carp) rhodopsin is a G protein-coupled receptor (GPCR) with seven transmembrane segments. The carp rhodopsin cDNA consists of 1584 nucleotides containing a single open reading frame of 1062 nucleotides (positions 72 to 1133), which encodes a 354 amino acid polypeptide . Like other visual pigments, carp rhodopsin contains a conserved lysine residue in transmembrane helix 7 that serves as the linkage site for the retinal chromophore, and a carboxylic acid residue in helix 3 that functions as the counterion to the protonated Schiff base . The sites of palmitoylation, glycosylation, disulfide bond formation, and Schiff base formation are all conserved in carp rhodopsin .

Sequence identity comparison with other species:

SpeciesSequence Identity (%)
Goldfish95.7
Sand goby85.5
Lamprey74.4
  • How does the rhodopsin gene differ between carp varieties and strains?

Genetic diversity studies of different carp varieties, particularly koi (Japanese ornamental carp), have identified polymorphisms in the red sensitive opsin gene. Analysis of SNPs (Single Nucleotide Polymorphisms) in the red sensitive opsin gene has helped distinguish between common carp and koi strains . In one study examining color phenotypes in koi, researchers found that the red sensitive opsin gene contained heterozygous positions at nucleotides 1076, 1118, and 1350 in koi haplotypes, whereas common carp was homozygous at these positions (A/A at position 1076, T/T at position 1118, and G/G at position 1350) . Phylogenetic analysis based on red sensitive opsin, cytochrome b, and D-loop polymorphisms has successfully differentiated common carp from koi strains .

  • What experimental methods are used to clone and express carp rhodopsin?

The cloning of carp rhodopsin typically involves screening a retinal cDNA library to isolate the rhodopsin gene. For the original characterization, researchers screened a carp retinal cDNA library and isolated a recombinant phage clone containing the 1584 nucleotide rhodopsin cDNA .

For expression of recombinant rhodopsin, several systems have been documented, with methodologies adaptable to carp rhodopsin:

  • Baculovirus/Sf9 insect cell system: This system has been optimized for large-scale production of recombinant eukaryotic integral membrane proteins like rhodopsin. Using serum-free and protein-free growth medium in bioreactor cultures, expression levels up to 4 mg/l have been achieved .

  • Mammalian cell expression: Cloning of rhodopsin into expression vectors (like EGFP-C1) with C-terminal tags (such as 1D4-tag) and transfection into HEK-293T cells has been used for rhodopsin expression. Proteins can be solubilized using detergents like DDM (Dodecylmaltoside) and CHS (Cholesteryl hemisuccinate) .

  • Pichia pastoris expression: For rhodopsin fragments, human codon-optimized sequences with C-terminal StrepII-tags have been cloned into pPICZ plasmids, with expression induced by adding 2.5% methanol to culture media .

Advanced Research Questions

  • What are the optimal conditions for purifying functional recombinant carp rhodopsin?

Purification of functional recombinant carp rhodopsin requires careful consideration of detergents, affinity tags, and buffer conditions. Based on methodologies for rhodopsin purification:

  • Solubilization: After cell harvesting, solubilize membranes in HBS buffer (50 mM HEPES pH 7.4; 100 mM NaCl) containing 2% Dodecylmaltoside (DDM) and 0.4% Cholesteryl hemisuccinate (CHS) .

  • Affinity purification options:

    • For 1D4-tagged constructs: Use Rho1D4 affinity beads (such as from CUBE Biotech)

    • For StrepII-tagged constructs: Use Strep-TactinXT 4Flow affinity beads (such as from IBA Lifesciences)

  • Critical considerations:

    • Perform all operations under dim red light to prevent photobleaching

    • Maintain low temperature (4°C) throughout purification

    • Include appropriate protease inhibitors

    • For reconstitution into a native lipid environment, consider incorporating the purified protein into lipid vesicles or nanodiscs

Studies with bovine rhodopsin have shown that after reconstitution into a native lipid environment, purified recombinant protein can be functionally indistinguishable from native rhodopsin regarding spectral absorbance, structural changes after photoactivation, and G-protein activation .

  • How can the functional properties of recombinant carp rhodopsin be assessed?

Functional assessment of recombinant carp rhodopsin involves multiple complementary methods:

  • Spectroscopic characterization:

    • UV-visible absorption spectroscopy to confirm chromophore binding and proper folding

    • Resonance Raman spectroscopy to investigate retinal-protein interactions

    • Fourier-transform infrared (FTIR)-difference spectroscopy to study conformational changes

    • NMR spectroscopy for detailed structural analysis

  • Light-induced conformational changes:

    • Flash photolysis to measure the kinetics of photoactivation

    • Monitoring formation of photointermediates (particularly meta-II formation)

    • Light scattering assays to detect structural reorganization

  • G-protein activation assays:

    • GTPγS binding assays to measure the rate of nucleotide exchange on G-proteins

    • G-protein interaction studies using purified transducin

  • Mutagenesis studies:

    • Site-directed mutagenesis of key residues (e.g., Lys-296, Glu-113) to assess their roles in function

    • Comparison of mutant properties with wild-type to identify critical amino acids

The assessment should focus on key aspects of rhodopsin function including proper folding, chromophore binding, photoisomerization, and G-protein coupling capability.

  • What are the implications of genome duplication in Cyprinus carpio for rhodopsin gene evolution?

The common carp (Cyprinus carpio) is an allotetraploid species derived from whole genome duplication, which has significant implications for rhodopsin gene evolution:

  • Subgenome divergence: Analysis of homoeologous genes in the two subgenomes of C. carpio reveals a substitution rate of 0.16, suggesting that the two subgenomes diverged approximately 8.2 million years ago . This may have led to functional divergence of rhodopsin genes between the two subgenomes.

  • Gene fate after duplication: Following genome duplication, duplicated genes typically undergo:

    • Subfunctionalization: 306 orthologous triplet genes show differential expression patterns between subgenomes, suggesting subdivision of ancestral functions

    • Neofunctionalization: 293 genes in subgenome A and 228 genes in subgenome B maintain conserved expression patterns with their orthologues while homoeologous copies in the opposite subgenome are differentially expressed

    • Nonfunctionalization: 191 and 620 homoeologous gene pairs are solely transcribed in subgenomes A and B respectively, with the other copies silenced

  • Implications for rhodopsin research: When studying carp rhodopsin, researchers should:

    • Determine which subgenome's rhodopsin gene is being investigated

    • Consider potential functional differences between homoeologous rhodopsin genes

    • Assess expression patterns across tissues to identify potential subfunctionalization

    • Design primers and experimental approaches that can distinguish between highly similar homoeologous genes

The genomic complexity of carp offers unique opportunities to study the evolution of rhodopsin genes after whole genome duplication.

  • How can molecular modeling and simulations enhance our understanding of carp rhodopsin structure-function relationships?

Molecular modeling and simulations provide powerful tools to investigate carp rhodopsin structure-function relationships:

  • Homology modeling: Using known structures (like bovine rhodopsin) as templates, researchers can generate detailed 3D models of carp rhodopsin. Tools like AlphaFold-Multimer can model rhodopsin complexes, as demonstrated with other rhodopsins .

  • Molecular dynamics (MD) simulations: MD simulations can reveal:

    • Dynamic behavior of the protein in a membrane environment

    • Conformational changes associated with activation

    • Interactions between rhodopsin and retinal chromophore

    • Effects of mutations on structure and dynamics

  • Methodology for rhodopsin simulations:

    • Embed models in lipid bilayers (e.g., POPC) using tools like CHARMM-GUI

    • Solvate with water models (e.g., TIP3P) and add physiological ion concentrations

    • Apply appropriate force field parameters for retinal

    • Consider different protonation states of key residues

  • Quantum mechanics/molecular mechanics (QM/MM) approaches: For studying photoisomerization processes and proton transfer events, QM/MM methods can provide insights into electronic structure changes during activation .

  • Analysis of key residues: Special attention should be paid to:

    • Lys-296: The site of Schiff base linkage to retinal

    • Glu-113: The counterion to the protonated Schiff base

    • Conserved disulfide bond between Cys-110 and Cys-187

    • Gly-121: Potentially involved in activation mechanisms

Simulations can generate testable hypotheses about structure-function relationships that can guide experimental mutagenesis studies.

  • How can recombinant carp rhodopsin be utilized in optogenetic applications?

Recombinant carp rhodopsin holds potential for optogenetic applications by leveraging its light-sensing properties:

  • Rhodopsin-based photo-electrosynthetic systems: Recent research has demonstrated that rhodopsins (such as Gloeobacter rhodopsin) can be engineered into bacteria like Ralstonia eutropha to create light-dependent electron transfer chains that drive CO₂ fixation . Similar approaches could utilize carp rhodopsin:

    • Gene cluster construction: Creating synthetic gene clusters that include:

      • The rhodopsin gene from carp

      • Genes for retinal biosynthesis (e.g., β-carotene pathway genes and blh for conversion to retinal)

      • Appropriate promoters for expression in target organisms

  • Engineering considerations for carp rhodopsin optogenetics:

    • Codon optimization: Adapt the carp rhodopsin gene sequence for expression in target organisms

    • Fusion constructs: Design chimeric proteins combining carp rhodopsin with functional domains from other proteins

    • Spectral tuning: Introduce mutations to modify absorption spectra for specific light sensitivities

    • Expression system: Select appropriate heterologous expression systems for functional testing

  • Applications in CO₂ fixation and biofuel production:

    • Light-driven proton pumping for ATP synthesis

    • Coupling with electron transfer mechanisms for carbon fixation

    • Integration with metabolic engineering for production of valuable compounds

  • Testing functional properties:

    • Light-dependent growth assays in engineered organisms

    • Measurement of proton pumping activity

    • Assessment of electron transfer efficiencies

    • Quantification of carbon fixation rates under varying light conditions

The unique properties of carp rhodopsin could offer advantages for specific optogenetic applications compared to other microbial rhodopsins currently in use.

  • What role do post-translational modifications play in carp rhodopsin function?

Post-translational modifications (PTMs) are critical for proper rhodopsin folding, trafficking, and function:

  • Glycosylation:

    • Carp rhodopsin, like other vertebrate rhodopsins, contains conserved glycosylation sites

    • Studies on bovine rhodopsin indicate that glycosylation at Asn-15 is required for full signal transduction activity, though not for correct biosynthesis or folding

    • Methodology to study glycosylation: Use site-directed mutagenesis to create N-to-Q mutations at potential glycosylation sites and assess impact on function

  • Palmitoylation:

    • Conserved palmitoylation sites are present in carp rhodopsin

    • In bovine rhodopsin, palmitoylation occurs at cysteine residues in the C-terminal tail

    • Methodology to study palmitoylation: Use metabolic labeling with [³H]palmitic acid followed by fluorography, or chemical approaches like hydroxylamine sensitivity assays

  • Disulfide bond formation:

    • The disulfide bond between conserved cysteines (Cys-110 and Cys-187 in bovine rhodopsin) is essential for proper folding

    • Methodology to study disulfide bonds: Create cysteine-to-alanine mutations and assess folding and function; analyze redox state using non-reducing SDS-PAGE

  • Phosphorylation:

    • Light-dependent phosphorylation of serine and threonine residues at the C-terminal tail regulates rhodopsin desensitization

    • Methodology to study phosphorylation: Use radioactive [³²P]ATP labeling or phospho-specific antibodies; create phosphorylation-deficient mutants by replacing Ser/Thr with Ala

  • Experimental approaches to study PTMs in carp rhodopsin:

    • Mass spectrometry to identify and map PTMs

    • Site-directed mutagenesis to eliminate specific modification sites

    • Functional assays to determine the impact of PTM-deficient mutants

    • Cellular trafficking studies using fluorescently tagged constructs

Understanding these modifications is essential for producing properly folded and functional recombinant carp rhodopsin.

  • How does DNA methylation affect rhodopsin gene expression in Cyprinus carpio?

DNA methylation is an important epigenetic modification that can regulate gene expression. In Cyprinus carpio:

  • Methylation patterns in carp genomes:

    • Studies on allotetraploid hybrids of Carassius auratus red var. and Cyprinus carpio L. show 38.31% methylation changes compared to parents at 355 randomly selected CCGG sites

    • The level of methylation modification in allotetraploid hybrids appears increased relative to parents

  • Methodologies to study DNA methylation in rhodopsin genes:

    • Methylation-sensitive amplification polymorphism (MSAP) analysis: This technique uses the differential sensitivity of isoschizomeric restriction enzymes (MspI and HpaII) to cytosine methylation in CCGG sequences

    • Bisulfite sequencing: Converts unmethylated cytosines to uracil while leaving methylated cytosines unchanged, allowing direct assessment of methylation patterns

    • Methylated DNA immunoprecipitation (MeDIP): Uses antibodies against 5-methylcytosine to enrich for methylated DNA fragments

  • Interpretation of methylation patterns:

    • Different patterns observed in MSAP analysis indicate different methylation states:

      • Band amplification after both MspI and HpaII: unmethylated CCGG site

      • Band amplification after MspI only: internally fully-methylated site (CmCGG)

      • Band amplification after HpaII only: externally hemi-methylated site (mCCGG)

      • No amplification: full methylation of all cytosines or site mutation

  • Functional implications:

    • Hypermethylation often occurs on genes related to metabolism or cell cycle regulation in allotetraploid hybrids

    • Methylation changes might be related to gene expression and phenotype variation in allotetraploid hybrids

    • These findings suggest potential epigenetic regulation of rhodopsin gene expression in different carp varieties

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.