Recombinant Cytochrome b559 subunit alpha (psbE)

Shipped with Ice Packs
In Stock

Description

Role in PSII Assembly and Stability

PsbE is indispensable for the assembly of stable PSII reaction centers. Deletion mutants of psbE in Synechocystis sp. PCC 6803 and Chlamydomonas reinhardtii fail to accumulate functional PSII, leading to photoautotrophic growth defects .

Key Mechanisms:

  1. Structural Nucleation: PsbE interacts with D2 (PsbD) during early PSII assembly, forming a core complex essential for subsequent protein integration .

  2. Heme Coordination: Mutations disrupting His ligands (e.g., H23Aα in T. elongatus) destabilize the heme, but apoproteins (PsbE/PsbF without heme) still enable PSII assembly in thermophilic organisms .

  3. Electrostatic Interactions: Arg residues (e.g., R7α, R17α) in PsbE stabilize heme propionates via charge interactions, influencing redox properties .

Photoprotection and Redox Functions

PsbE contributes to secondary electron transfer pathways that mitigate photoinhibition:

PathwayMechanismEvidence
Donor-Side ProtectionCyt b559⁻ reduces P680⁺ via β-carotene (CarD2)Observed in HP-form-enriched PSII under high light
Acceptor-Side ProtectionLP-form Cyt b559 oxidizes PQH₂ to prevent ROS formationDemonstrated in tris-washed PSII
Superoxide ModulationCyt b559 exhibits superoxide oxidase/reductase activity in isolated PSIIConfirmed via EPR and spectroscopy

Interactions with PsbP:
The N-terminal sequence of PsbP (pN15 peptide) binds PsbE, altering Cyt b559’s redox potential and oxygen-evolving activity. This interaction modulates electron flow and stabilizes the OEC .

Heme-Ligand Mutants

OrganismMutationPhenotype
SynechocystisR7Eα, R17LβSlower growth, LP-form dominance, impaired photoprotection
T. elongatusH23Aα, H23MαApo-Cyt b559 assembled; stable PSII despite heme loss

Gene Amplification in Cyanobacteria

In Synechocystis mutants with destabilized PsbE/PsbF, tandem repeats of the psbEFLJ operon restore PSII accumulation:

FeatureWild-TypeMutant + Amplicon
psbEFLJ Copies15–15
RNA LevelsBasal10–20× elevated
PSII Content100%Recovered to ~80%

This mechanism compensates for protein instability via overexpression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbE; Cytochrome b559 subunit alpha; PSII reaction center subunit V
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-81
Protein Length
Full Length of Mature Protein
Species
Mesostigma viride (Green alga)
Target Names
psbE
Target Protein Sequence
AGSTEERPFSDIITSIRYWVIHSITIPSLFVSGWLFVSTGLAYDVFGTPRPNEYFTEDRQ DIPLITDRFNALEQLNQYTK
Uniprot No.

Target Background

Function

This b-type cytochrome is integrally associated with the photosystem II (PSII) reaction center. PSII, a light-driven water:plastoquinone oxidoreductase, utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient for subsequent ATP synthesis. It comprises a core antenna complex for photon capture and an electron transfer chain that converts photonic excitation into charge separation.

Protein Families
PsbE/PsbF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.