Recombinant Cytochrome b561 (cybB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cybB; SF1794; S1478; Cytochrome b561; Cytochrome b-561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Shigella flexneri
Target Names
Target Protein Sequence
MENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMIHVSCGISILVLMVVRL LLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIGLVMMYNRGNPWFAFGLTMP YASEANFERVDSLKSWHETLANLGYFVIGLHAAAALAHHYFWKDNTLLRMMPRKRS
Uniprot No.

Target Background

Function
B-type di-heme cytochrome exhibiting a prominent alpha-absorption peak at 561 nm and a secondary peak at 555 nm.
Database Links

KEGG: sfl:SF1794

Protein Families
Cytochrome b561 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b561 and what cellular functions does it perform?

Cytochrome b561 (CYB561) represents a family of transmembrane proteins characterized by their ascorbate reducibility and trans-membrane electron transferring capability. These proteins contain two heme redox centers positioned on opposite sides of the host membrane, allowing them to facilitate electron transfer across biological membranes. CYB561 proteins are distributed across a wide range of animal and plant phyla and are typically localized in membranes distinct from those involved in bioenergization processes .

The primary function of CYB561 involves ascorbate-dependent oxidoreduction processes. As demonstrated in structural and biochemical studies, CYB561 acts as an electron transfer protein that can accept electrons from ascorbate on one side of the membrane and transfer them to an acceptor on the opposite side. This capability makes them crucial components in various cellular processes that require transmembrane electron transport .

How does the structure of CYB561 relate to its function?

The high-resolution crystal structures of Cytochrome b561 from Arabidopsis thaliana reveal that CYB561 forms a homodimer, with each protomer consisting of six transmembrane helices and two heme groups. This structural arrangement is essential for its function as an electron transfer protein. The negatively charged substrate (ascorbate or monodehydroascorbate) is enclosed in positively charged pockets on either side of the membrane .

Two highly conserved amino acids, Lys81 and His106, have been identified as playing essential roles in substrate recognition and catalysis. The distance between the two heme centers allows for efficient electron transfer across the membrane. This structure-function relationship explains how CYB561 can accept electrons from cytoplasmic ascorbate and transfer them to an acceptor on the non-cytoplasmic side .

What differentiates various members of the CYB561 protein family?

Members of the CYB561 family share strong sequence homology and conserved functional characteristics, but they exhibit distinct tissue distribution patterns and potentially different physiological roles. For example, two homologous proteins in both humans and rodents (CYB561D1 and CYB561D2) are thought to participate in cancer pathology through mechanisms that are still being investigated .

The mouse Cyb561d1 gene shows highest expression in thymus, spleen, colon, and large intestine, suggesting a tissue-specific function. Other members of the CYB561 family have been implicated in diverse biological processes including retinoid X receptor upregulation in pancreatic β-cells, aging mechanisms, type 2 diabetes, and cognitive function .

What expression systems are most effective for producing recombinant CYB561?

Yeast expression systems have proven particularly effective for producing recombinant CYB561 proteins. Researchers have successfully expressed both human and mouse orthologs of CYB561D2 and CYB561D1 in yeast systems, allowing for subsequent purification and characterization .

When establishing an expression system for CYB561, researchers should consider:

  • Screening multiple orthologs from different species to identify those with optimal expression levels

  • Evaluating solution behavior characteristics that impact purification efficiency

  • Assessing protein stability and crystallization properties if structural studies are planned

The Arabidopsis thaliana Cyt b561-B protein has demonstrated particularly favorable expression characteristics in recombinant systems, yielding sufficient quantities for high-resolution structural determination .

What purification strategies enhance the quality of recombinant CYB561?

Effective purification of recombinant CYB561 requires careful consideration of the protein's redox state. Treatment with ferricyanide during protein purification has been shown to markedly improve protein homogeneity by oxidizing the heme groups in CYB561 . This approach not only enhances protein quality but also significantly improves crystallization properties and diffraction quality when structural studies are planned.

For spectroscopic characterization, maintaining the integrity of both heme centers during purification is critical. Purification protocols should be designed to minimize heme loss and prevent protein degradation, which can be monitored through the appearance of characteristic EPR signals (e.g., around g = 2.98) that have been associated with protein degradation in previous studies .

How can experimental design be optimized to avoid artifacts in CYB561 studies?

Proper experimental design is crucial for obtaining reliable results in CYB561 research. A systematic randomization approach should be implemented during data collection and experimental ordering (e.g., plating) to prevent confounding with respect to the phenotypes of interest. Without proper randomization, studies risk producing spurious associations due to confounding factors, making it difficult to distinguish real associations from experimental artifacts .

Key considerations include:

  • Randomizing sample processing order relative to experimental conditions

  • Including appropriate controls for each experimental batch

  • Implementing strategies to detect and correct for batch effects during data analysis

  • Avoiding the combination of poorly randomized experiments in meta-analyses

Research has shown that approximately 95% of genetic studies analyze have major problems with experimental design, particularly related to randomization, resulting in endless struggles with spurious associations .

What spectroscopic methods are most informative for characterizing CYB561?

A multi-spectroscopic approach provides the most comprehensive characterization of CYB561 proteins:

  • Optical Spectroscopy: Allows monitoring of the redox state of heme centers and assessment of ascorbate reducibility. The characteristic absorption peaks can identify the coordination state of heme iron and detect changes upon substrate binding or reduction .

  • EPR Spectroscopy: Provides detailed information about the electronic environment of the heme centers. EPR can distinguish between different types of low-spin heme configurations, including highly asymmetric low-spin (HALS) character observed in some CYB561 proteins like Mm_CYB561D1 .

  • CD Spectroscopy: Offers insights into the secondary structure composition of the protein, helping confirm proper protein folding and structural integrity .

How can the electron transfer mechanism of CYB561 be experimentally assessed?

Investigating the electron transfer mechanism of CYB561 requires a combination of spectroscopic methods and targeted mutagenesis:

  • Ascorbate Reduction Assays: Monitor the ability of ascorbate to reduce the oxidized heme centers through changes in absorption spectra. The kinetics of these changes provide insights into the electron transfer efficiency .

  • Site-Directed Mutagenesis: Mutations targeting key residues in the ascorbate-binding pockets can reveal their roles in the electron transfer mechanism. For example, studies have shown that mutations K81A/R150A (on the cytoplasmic side) or F105W/H106E (on the non-cytoplasmic side) can significantly impact electron transfer from ascorbate .

  • Redox Potential Measurements: Determining the midpoint potentials of the two heme centers helps understand the thermodynamic feasibility of electron transfer across the membrane.

Research has demonstrated that mutations affecting both sides of the membrane (K81A/R150A/F105W/H106E) completely abolish ascorbate-mediated reduction, confirming the importance of these residues in the electron transfer pathway .

What structural modeling approaches provide insights into CYB561 function?

Homology modeling represents a valuable approach for investigating CYB561 proteins when high-resolution experimental structures are unavailable. Effective structural modeling strategies include:

  • Using the high-resolution crystal structure of Arabidopsis thaliana CYB561 (1.7 Å resolution) as a template for modeling other CYB561 family members .

  • Focusing on conserved structural features, particularly the six transmembrane helical segments and the coordination environment of the two heme groups.

  • Validating structural models through comparison with spectroscopic data, especially concerning the environments of the heme centers.

Structural analysis reveals that CYB561 shares architectural similarities with cytochrome b6, though with distinct heme coordination and electron donor/acceptor systems. While cytochrome b6 uses hydroquinone/plastocyanin as its electron donor/acceptor pair, CYB561 operates with ascorbate/monodehydroascorbate or ascorbate/ferric-chelate .

How do mutations in key residues affect the electron transfer capabilities of CYB561?

Systematic mutation studies have provided critical insights into the electron transfer mechanism of CYB561 proteins:

Mutation(s)LocationEffect on Ascorbate ReductionImplication
K81A/R150ACytoplasmic sideReduction from non-cytoplasmic side onlyCritical for cytoplasmic electron acceptance
Y140WCytoplasmic sidePartial reduction retainedModerate impact on binding
F105W/H106ENon-cytoplasmic sideReduction from cytoplasmic side onlyCritical for non-cytoplasmic electron acceptance
Y115WNon-cytoplasmic sidePartial reduction retainedModerate impact on binding
K81A/R150A/F105W/H106EBoth sidesComplete loss of reduction by ascorbateConfirms two-sided electron transfer pathway

These experimental results demonstrate that Lys81 and His106 are particularly crucial for electron transfer. The amino acid corresponding to Lys81 has also been shown to be important in other CYB561 orthologs, where mutation or chemical modification negatively affects electron acceptance from ascorbate .

What is known about the potential role of CYB561 proteins in cancer pathology?

Several members of the CYB561 family have been implicated in cancer-related processes, though the exact mechanisms remain under investigation. Two proteins of particular interest are:

  • Human tumor suppressor 101F6 protein (Hs_CYB561D2) and its mouse ortholog (Mm_CYB561D2), which have been extensively characterized in recombinant form. Recent studies have directly demonstrated the ferric reductase activity of detergent-purified and lipid nanodisc-embedded Hs_CYB561D2 .

  • CYB561D1 proteins (human and mouse orthologs), which may also play roles in cancer processes. The expression pattern of mouse Cyb561d1 in immune-related tissues (thymus, spleen) and digestive system (colon, large intestine) suggests potential roles in immune surveillance or epithelial cell regulation that could influence cancer development .

Understanding the redox properties and electron transfer capabilities of these proteins provides mechanistic insights into how they might influence cellular processes relevant to cancer biology, such as regulation of oxidative stress or iron metabolism.

How can advanced bioinformatics approaches enhance the study of CYB561 regulation?

Advanced bioinformatics approaches are revolutionizing our understanding of gene regulation, including for genes like CYBB (which encodes a related cytochrome):

  • Topologically Associated Domain (TAD) Analysis: Examining the entire TAD surrounding a gene of interest (spanning hundreds of kilobases) can reveal distant regulatory elements that influence expression. For example, analysis of the 600-kb TAD surrounding the CYBB gene identified 15 putative enhancer elements .

  • DNase I Hypersensitivity Site Mapping: This approach can identify active regulatory regions, as demonstrated in the identification of an enhancer element in intron 3 of the CYBB gene that increased expression over 2.5-fold in neutrophils and monocytes .

  • Transcription Factor Binding Site Analysis: Using ChIP-seq data from resources like ENCODE can identify binding sites for lineage-specific transcription factors. For instance, myeloid-associated transcription factors such as PU.1, SP1, and GABP were identified within regulatory elements of CYBB .

These approaches could be similarly applied to CYB561 genes to better understand their tissue-specific regulation patterns and identify key regulatory elements that could be incorporated into expression constructs for more physiologically relevant studies.

What are common challenges in expressing and purifying functional recombinant CYB561?

Researchers frequently encounter several challenges when working with recombinant CYB561:

  • Variable Expression Levels: Expression levels can vary significantly between different orthologs. Screening multiple orthologs from humans and plants has proven necessary to identify candidates with high expression levels suitable for structural studies .

  • Protein Homogeneity Issues: The redox state of the heme groups can affect protein homogeneity. Treatment with ferricyanide during purification to oxidize the heme groups has been shown to improve protein homogeneity and crystallization properties .

  • Heme Incorporation: Ensuring proper incorporation of both heme groups is essential for functional studies. Incomplete heme incorporation can be detected through spectroscopic analysis, with characteristic changes in absorption spectra and EPR signals .

  • Protein Degradation: Degradation can be monitored through the appearance of specific EPR signals (e.g., around g = 2.98). Implementing optimized purification protocols and including appropriate protease inhibitors can help minimize degradation .

How can experimental design be optimized to ensure reproducible results in CYB561 research?

Rigorous experimental design is critical for obtaining reproducible results:

  • Randomization of Sample Processing: Samples should be randomized with respect to experimental conditions to prevent confounding. This is particularly important in genetic studies, where batch effects can lead to spurious associations .

  • Inclusion of Controls: Appropriate controls should be included in each experimental batch to detect and account for batch-to-batch variations. This is especially important when combining data from multiple experiments .

  • Standardization of Protocols: Detailed standardization of expression, purification, and characterization protocols helps ensure consistency across different experiments and between different researchers.

  • Validation with Multiple Approaches: Critical findings should be validated using multiple experimental approaches. For example, electron transfer capabilities can be assessed through both spectroscopic methods and functional assays .

Without proper randomization and experimental design, studies may struggle with spurious associations due to confounding, making it difficult to distinguish real biological phenomena from experimental artifacts .

What quality control measures are essential for verifying the integrity of recombinant CYB561?

Several quality control measures are essential when working with recombinant CYB561:

  • Spectroscopic Analysis: Optical spectroscopy can verify the proper incorporation of heme groups and assess the protein's redox state. The characteristic absorption peaks of properly folded CYB561 provide a quick assessment of protein quality .

  • Size Exclusion Chromatography: This technique helps evaluate protein homogeneity and detect potential aggregation or degradation.

  • EPR Spectroscopy: EPR can provide detailed information about the electronic environment of the heme centers and detect signals associated with protein degradation, such as the appearance of peaks around g = 2.98 .

  • Functional Assays: Measuring the protein's ability to be reduced by ascorbate provides a functional assessment of its integrity. Variants with mutations in key residues (such as K81A/R150A/F105W/H106E) that abolish ascorbate reduction can serve as negative controls .

  • CD Spectroscopy: This approach helps verify proper protein folding by assessing secondary structure content, providing an additional layer of quality control beyond heme-specific measurements .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.