Recombinant Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle (petC-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
petC-1; Cytochrome b6-f complex iron-sulfur subunit 1, cyanelle; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein 1; Rieske iron-sulfur protein 1; ISP 1; RISP 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
61-239
Protein Length
full length protein
Species
Cyanophora paradoxa
Target Names
petC-1
Target Protein Sequence
CSAASDDVPDMGKRKLMNLLLLGAIAGPVAGAGGPFVSFLVPPKAGGGAGAGQAAKDALG NDVKVSSWLETHKPGDRSLAQGLKGDATYLIVKEDGTLENYGLNAVCTHLGCVVPWNASE NKFMCPCHGSQYDRTGKVVRGPAPLSLALAHVSVLEDGVVAFEPWTETDFRTNTAPWWK
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Subcellular Location
Plastid, cyanelle thylakoid membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of PetC in the cytochrome b6f complex?

    The PetC protein (Rieske iron-sulfur protein) is one of the large subunits of the cytochrome b6f complex involved in photosynthetic and respiratory electron transfer. It contains a 2Fe-2S iron-sulfur cluster that accepts electrons from plastoquinol and transfers them to cytochrome f. Structurally, PetC consists of a membrane-anchoring domain and an extrinsic domain containing the iron-sulfur cluster. This cluster is coordinated by two cysteine residues and two histidine residues, giving it unique redox properties with a relatively high potential (+300 mV). The iron-sulfur cluster in PetC is essential for the Q-cycle mechanism that couples electron transfer to proton translocation across the thylakoid membrane, contributing to the proton motive force used for ATP synthesis .

  • How do PetC isoforms differ in cyanobacteria and what are their functional roles?

    In cyanobacteria such as Synechocystis PCC 6803, three petC genes encode potential Rieske subunits (PetC1, PetC2, PetC3) with distinct functional roles:

    IsoformPrimary FunctionDeletion EffectsReplacement Capability
    PetC1Main Rieske subunit in electron transferIndividual deletion has minimal phenotypic effectsCannot be deleted together with PetC2
    PetC2Secondary/backup Rieske componentIndividual deletion has minimal phenotypic effectsCan partly replace PetC1
    PetC3Specialized function with alternative electron donorsCan be deleted with either PetC1 or PetC2Cannot functionally replace PetC1 or PetC2

    PetC1 is the predominant isoform, while PetC3 may interact with special electron donors with lower redox potentials than plastoquinone. This evolutionary diversification allows cyanobacteria to optimize electron transfer under varying environmental conditions .

  • What techniques are effective for detecting PetC in experimental samples?

    Multiple complementary approaches can be used to detect and quantify PetC:

    • Immunoblotting: Use polyclonal antibodies against conserved PetC peptide sequences. Commercial antibodies (e.g., AS08 330 from Agrisera) work across multiple species including Arabidopsis, Chlamydomonas, and cyanobacteria at dilutions of 1:5000-1:10000 .

    • Blue Native PAGE (BN-PAGE): Preserves protein-protein interactions, allowing visualization of the intact cytochrome b6f complex followed by immunodetection with PetC antibodies .

    • Mass Spectrometry: Electrospray ionization mass spectrometry can accurately determine the molecular mass of PetC subunits (e.g., 19.3 kDa for PetC from spinach thylakoids) .

    • Spectroscopic Methods: The iron-sulfur cluster exhibits characteristic absorption and EPR spectral features that can be used for detection and redox state analysis.

    • Functional Assays: Measuring electron transfer rates from plastoquinol to plastocyanin can indirectly assess PetC activity .

  • What expression systems are suitable for producing recombinant PetC?

    Successful expression of functional recombinant PetC requires specific approaches:

    • E. coli Expression Systems: The most common approach, especially with specialized vectors designed for membrane proteins. In vitro E. coli expression systems have successfully produced functional PetC proteins .

    • Codon Optimization: Essential when expressing cyanobacterial or plant genes in bacterial systems to improve protein yield.

    • Fusion Tags: Addition of affinity tags (His, Strep) facilitates purification while maintaining protein function. The cytochrome b6f complex has been successfully purified using strep-tagged constructs (e.g., petA-strep) .

    • Inclusion of Lipids: Adding specific lipids during purification is critical for maintaining proper structure and function, as lipids are essential for proper folding and stability of the cytochrome b6f complex .

    • Refolding Protocols: Often necessary when PetC forms inclusion bodies, requiring denaturation and carefully controlled refolding to incorporate the iron-sulfur cluster correctly.

Advanced Research Questions

  • What conformational changes does PetC undergo during electron transfer and how can they be studied?

    PetC undergoes significant conformational changes during electron transfer that are critical to its function:

    • The extrinsic domain containing the iron-sulfur cluster moves between two positions: one proximal to the quinol oxidation site (Q₀) and another closer to cytochrome f.

    • This movement allows PetC to accept electrons from plastoquinol at the Q₀ site and donate them to cytochrome f.

    • Domain movement distance: approximately 16-22 Å based on structural studies.

    Methodological approaches to study these conformational changes include:

    • 3D-Variability Analysis (3DVA) of cryo-EM data can capture different conformational states of PetC. Studies on Synechocystis sp. PCC 6803 cytb6f have used masks focused on the p-side extrinsic domains to visualize these movements .

    • Molecular Dynamics Simulations to model the energetics and kinetics of the conformational changes.

    • Cross-linking experiments combined with mass spectrometry to identify residues that come into proximity during different conformational states.

    • EPR Spectroscopy with site-directed spin labeling to measure distances between specific residues during conformational changes .

  • How do PetC mutations affect electron transfer and what methodologies are best for studying these effects?

    PetC mutations can significantly impact electron transfer through several mechanisms:

    Mutation TargetEffect on FunctionDetection Method
    Fe-S cluster ligandsAltered redox potential or cluster stabilityEPR spectroscopy, redox titrations
    Hinge regionsImpaired domain movementTime-resolved spectroscopy, fluorescence resonance energy transfer
    Interface with cytochrome b6Disrupted quinol binding/oxidationEnzyme kinetics, inhibitor binding studies
    Interface with cytochrome fAltered electron donation rateFlash photolysis, cytochrome reduction assays

    Methodological approaches to study mutation effects include:

    • Site-directed mutagenesis targeting specific residues followed by functional characterization.

    • Redox potential measurements using potentiometric titrations to assess changes in iron-sulfur cluster properties.

    • Electron transfer kinetics measurements using stopped-flow spectroscopy or flash photolysis.

    • Structural studies via X-ray crystallography or cryo-EM to visualize how mutations alter protein conformation.

    • Computational approaches such as quantum mechanics/molecular mechanics (QM/MM) simulations to predict effects of mutations on electron transfer pathways .

  • What are the technical challenges in crystallizing cytochrome b6f complex with intact PetC and how can they be overcome?

    Crystallizing the cytochrome b6f complex presents several technical challenges:

    • Proteolysis Issues: The complex is prone to proteolysis during lengthy crystallization periods, degrading the quality of crystals. This issue proved refractory to inhibition by standard protease inhibitors during crystallization attempts with cyanobacterial b6f complexes .

    • Conformational Heterogeneity: The mobile PetC domain introduces structural variability that complicates crystal formation.

    • Lipid Requirement: Specific lipids are essential for proper complex structure and stability. The addition of lipids was found to be critical in successful crystallization attempts, with prominent crystals appearing rapidly when appropriate lipids were included .

    Solutions that have proven successful include:

    • Lipid Supplementation: Adding specific lipids during purification and crystallization. This approach dramatically improved crystal formation, with crystals appearing overnight rather than weeks in the case of the cyanobacterial complex .

    • Use of Antibody Fragments: Co-crystallization with Fab fragments can stabilize specific conformations and provide additional crystal contacts.

    • Detergent Screening: Systematic testing of different detergents and detergent:protein ratios to identify optimal conditions.

    • Alternative Approaches: Using cryo-EM instead of crystallography to overcome some of these challenges, allowing visualization of multiple conformational states and eliminating the need for crystal formation .

  • How does PetC contribute to alternative electron transport pathways in cyanobacteria and plants?

    PetC participates in multiple electron transport pathways beyond linear electron flow:

    • Cyclic Electron Flow: PetC facilitates electron transfer from ferredoxin back to the plastoquinone pool via the cytochrome b6f complex, generating additional ATP without net NADPH production.

    • Respiratory Electron Transport: In cyanobacteria, the cytochrome b6f complex and its PetC subunit participate in respiratory electron transport, accepting electrons from the NAD(P)H dehydrogenase complex.

    • Chlororespiration: PetC may participate in chlororespiration pathways involving plastoquinone oxidation in the dark.

    Methodological approaches to study these alternative pathways include:

    • Differential analysis of petC mutants: Comparing phenotypes of petC1, petC2, and petC3 mutants under different growth conditions (light/dark cycles, nutrient limitation) .

    • Oxygen exchange measurements: Using membrane inlet mass spectrometry or oxygen electrodes to measure electron transport rates.

    • P700 redox kinetics: Monitoring photosystem I reaction center oxidation/reduction during light/dark transitions.

    • In vivo spectroscopic techniques: Using pulse-amplitude modulated fluorometry to assess photosynthetic parameters associated with alternative electron flows .

  • What analytical methods can determine if recombinant PetC correctly incorporates the iron-sulfur cluster?

    Verifying proper iron-sulfur cluster incorporation in recombinant PetC requires multiple analytical approaches:

    • UV-Visible Spectroscopy: The oxidized [2Fe-2S] cluster in PetC shows characteristic absorption peaks at approximately 330, 458, and 560 nm. The ratio of absorbance at 280 nm (protein) to 458 nm (iron-sulfur) provides a measure of cluster incorporation.

    • EPR Spectroscopy: The reduced [2Fe-2S] cluster gives a characteristic EPR signal with g-values around g = 1.89, 1.95, and 2.02. The signal intensity correlates with the amount of functional cluster.

    • Mössbauer Spectroscopy: Provides information about the oxidation state and coordination environment of iron in the cluster when using 57Fe-labeled protein.

    • Circular Dichroism (CD) Spectroscopy: The iron-sulfur cluster contributes to specific CD signals that confirm proper incorporation.

    • Functional Assays: Measuring electron transfer capabilities using artificial electron donors and acceptors.

    • Redox Titrations: Determining the midpoint potential of the cluster, which should be around +300 mV for properly formed PetC iron-sulfur clusters .

  • How can researchers optimize expression and stability of recombinant PetC for structure-function studies?

    Optimizing recombinant PetC production requires addressing several critical factors:

    • Expression Timing and Temperature: Lower temperatures (16-20°C) during induction often improve proper folding and iron-sulfur cluster incorporation.

    • Iron and Sulfur Supplementation: Adding iron (e.g., ferric ammonium citrate) and sulfur sources (e.g., cysteine) to the growth medium enhances iron-sulfur cluster formation.

    • Co-expression Strategies: Co-expressing iron-sulfur cluster assembly proteins (ISC or SUF system components) can improve incorporation of the cluster.

    • Stabilization through Protein Engineering:

      ModificationPurposeEffect on Stability
      Surface charge optimizationReduce aggregationImproves solubility
      Disulfide engineeringRestrict conformational flexibilityEnhances thermal stability
      Strategic glycine substitutionsModify flexibility at hinge regionsControls domain movement
      DeuterationEnhance NMR studiesImproves spectral resolution
    • Storage Conditions: Including reducing agents (e.g., 1-5 mM DTT), glycerol (10-20%), and appropriate salt concentrations (100-300 mM NaCl) protects the iron-sulfur cluster from oxidative damage during storage.

    • Reconstitution into Nanodiscs or Liposomes: For functional studies, incorporating purified PetC into membrane mimetics improves stability and better replicates the native environment .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.