Recombinant Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cytochrome b6-f Complex Iron-Sulfur Subunit (petC)

The recombinant Cytochrome b6-f complex iron-sulfur subunit, commonly known as petC, is a vital component of the cytochrome b6-f complex found in the thylakoid membranes of chloroplasts in plants, cyanobacteria, and green algae . This complex plays a crucial role in photosynthesis by mediating electron transfer between photosystem II (PSII) and photosystem I (PSI) . Simultaneously, it pumps protons into the thylakoid space, contributing to the generation of an electrochemical gradient used to synthesize ATP from ADP .

Structure and Function of Cytochrome b6-f Complex

The cytochrome b6-f complex typically exists as a dimer, with each monomer consisting of eight subunits . These subunits include four large subunits and four small subunits . The large subunits are:

  • A 32 kDa cytochrome f with a c-type cytochrome

  • A 25 kDa cytochrome b6 with low- and high-potential heme groups

  • A 19 kDa Rieske iron-sulfur protein (petC) containing a [2Fe-2S] cluster

  • A 17 kDa subunit IV
    The small subunits are PetG, PetL, PetM, and PetN . The total molecular weight of the complex is approximately 217 kDa .

The petC subunit, also known as the Rieske iron-sulfur protein, is essential for the electron transfer process within the complex . It contains a [2Fe-2S] cluster, which is critical for its redox activity .

Post-translational Modification

A study on the purified b6-f complex from Nostoc sp. PCC 7120 revealed an unprecedented post-translational modification . The Rieske iron-sulfur protein (PetC) was found to be acetylated at the N-terminus . This modification had not been previously observed in cyanobacterial membrane and electron transport proteins, nor in polypeptides of cytochrome bc complexes from other sources .

Importance of petC in Various Species

The petC protein is highly conserved across various species, making it a useful target for global antibodies that can be used to quantify petC from a wide range of organisms . The recombinant protein standard from Synechocystis PCC 6803 can be used in combination with global anti-PetC antibodies for quantitative western blotting .

Applications in Protein Expression and Purification

The Protein Expression Technology Center (PETC) facilitates the expression and purification of proteins, including petC, for structure/function studies . The center offers support in all aspects of protein expression, from cloning through expression optimization and protein purification .

Redox Behavior and Biological Activity

The redox behavior and biological activity of metal complexes, including those containing iron, have been investigated for their potential as anticancer agents . While these studies do not directly focus on petC, they highlight the importance of iron-containing complexes in biological systems and their potential therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; Rieske iron-sulfur protein; ISP; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-181
Protein Length
Full Length of Mature Protein
Species
Chlorobaculum thiosulfatiphilum (Chlorobium limicola f.sp. thiosulfatophilum)
Target Names
petC
Target Protein Sequence
AQTGNFKSPARMSSLGQGAAPASSGAVTGGKPREGGLKGVDFERRGFLHKIVGGVGAVVA VSTLYPVVKYIIPPARKIKNVDELTVGKASEVPDGKSKIFQFNEDKVIVVNKGGALTAVS AVCTHLGCLVNWVDADNQYFCPCHGAKYKLTGEIISGPQPLPLKQYKARIEGDSIIISKA
Uniprot No.

Target Background

Function
Component of the green S-bacteria bc-complex. This complex comprises the Rieske protein and cytochrome b subunit and lacks a cytochrome c1 equivalent, exhibiting a relatively low redox potential.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structural organization of the cytochrome b6-f complex and where does petC fit within it?

    The cytochrome b6-f complex functions as a homodimer with each monomer composed of four core subunits (PetA/cytochrome f, PetB/cytochrome b6, petC/Rieske iron-sulfur protein, and PetD/subunit IV) plus four small subunits (PetG, PetL, PetM, and PetN) that stabilize the complex . The petC subunit contains a Rieske-type [2Fe-2S] cluster that participates directly in the photosynthetic electron transport chain .

    In the functional complex, the hydrophilic domain of petC subunit moves toward the PetA subunit to transfer electrons from the Rieske iron-sulfur cluster to heme f . High-resolution cryo-EM structures have revealed that the petC subunit sits at a critical junction in the electron transfer pathway between the plastoquinol oxidation site (Qp) and the plastocyanin reduction site .

  • How does the cytochrome b6-f complex contribute to photosynthetic electron transfer?

    The cytochrome b6-f complex serves as a central hub in photosynthetic electron transfer through several key mechanisms:

    • It mediates electron transfer between photosystem II (PSII) and photosystem I (PSI)

    • It catalyzes the oxidation of plastoquinol and reduction of plastocyanin, a key step in photosynthesis

    • It operates according to a modified Q-cycle mechanism where electrons from plastoquinol oxidation follow two pathways:

      • High-potential pathway: transfer to plastocyanin via the Rieske iron-sulfur cluster and cytochrome f

      • Low-potential pathway: transfer to plastoquinone via hemes bp and bn

    • It participates in both linear electron transfer (LET) and cyclic electron transfer (CET), with the latter producing additional ATP without NADPH production

  • What are the key differences between the cytochrome b6-f complex and the related bc1 complex?

    Despite evolutionary relationships, these complexes exhibit several important distinctions:

    FeatureCytochrome b6-fCytochrome bc1
    Structural components8 polypeptide subunits including PetA, PetB, petC, and PetDSimilar core structure but different subunit organization
    Heme arrangementContains hemes f, bp, bn, and cnContains c-type and b-type hemes in different arrangement
    Cytochrome componentCyt f has predominantly β secondary structureCyt c1 has predominantly α secondary structure
    Additional prosthetic groupsContains an additional heme cn not found in bc1Lacks this additional heme
    LocationThylakoid membranes of chloroplastsInner mitochondrial membrane or bacterial plasma membrane
    Electron donors/acceptorsPlastoquinol/plastocyaninUbiquinol/cytochrome c

    The only conserved sequence element between cyt f and cyt c1 is the Cys-X-Y-Cys-His sequence responsible for covalent binding of the c-type heme .

  • What approaches are used to produce recombinant petC for research purposes?

    Recombinant petC production typically involves:

    • Expression of the soluble domain (removing the transmembrane anchor) in bacterial expression systems

    • Careful optimization of growth conditions to ensure proper iron-sulfur cluster formation

    • Purification using affinity chromatography followed by size exclusion chromatography

    • Verification of proper folding and iron-sulfur cluster incorporation using spectroscopic methods

    For example, studies with the thermophilic cyanobacterium Thermosynechococcus elongatus BP-1 successfully expressed and purified the extrinsic soluble domain of petC for structural characterization at 2.0 Å resolution . Commercial sources also offer recombinant petC proteins from various plant sources including rice (Oryza sativa) and tobacco .

Advanced Research Questions

  • How do specific mutations in petC affect electron transfer rates and photosynthetic control?

    Mutations in petC can significantly impact electron transfer kinetics and regulatory mechanisms. The most well-studied example is the Pro-to-Leu substitution:

    • In Arabidopsis thaliana, the pgr1 (proton gradient regulation 1) mutant contains a Pro194Leu substitution in petC

    • The equivalent mutation in Chlamydomonas reinhardtii (PETC-P171L) shows impaired non-photochemical quenching (NPQ) induction and slower photoautotrophic growth under high light conditions

    • The PETC-P171L mutation triggers photosynthetic control (pH-dependent slowdown of plastoquinol oxidation) at more alkaline lumen pH values

    • Under low oxygen conditions, this mutation results in:

      • Greater restriction of plastoquinol pool oxidation

      • Diminished electron flow through the b6f complex

      • Different cytochrome-f reduction half-times upon single cytochrome b6f turnover

    These studies demonstrate that key residues in petC play critical roles in regulating electron flow rates and the sensitivity of the complex to lumen pH .

  • What techniques are most effective for studying protein-protein interactions involving petC within the cytochrome b6-f complex?

    Several complementary approaches provide insights into petC interactions:

    1. Cryo-electron microscopy (cryo-EM): High-resolution (2.1-2.7 Å) structures have revealed petC interactions with other complex components and mobile electron carriers like plastocyanin

    2. Isothermal titration calorimetry (ITC): Useful for quantifying binding affinities between petC and interaction partners such as ferredoxin-NADP+ reductase (FNR)

    3. Crosslinking coupled with mass spectrometry: Identifies interaction interfaces between petC and other proteins

    4. Site-directed mutagenesis: Systematic modification of potential interaction residues to validate structural predictions

    5. FRET (Förster Resonance Energy Transfer): Measures distances between fluorescently labeled components to track dynamic interactions

    For example, cryo-EM structures of spinach cytochrome b6f complexed with plastocyanin revealed specific interaction interfaces that facilitate electron transfer from the Rieske iron-sulfur cluster to plastocyanin via cytochrome f .

  • How does the N-terminal region of proteins associated with petC affect cytochrome b6-f complex assembly and function?

    Recent research has identified critical roles for N-terminal regions in cytochrome b6-f function:

    • The N-terminal region of PetD (another subunit that works closely with petC) is essential for cytochrome b6f function

    • Truncation of PetD's N-terminal region (MSVTKKPD) significantly impairs electron transfer within the complex

    • PetD T4 phosphorylation regulates STT7 kinase activity, establishing a feedback loop that adds a new regulatory layer to b6f function

    • Without proper N-terminal structure, electron transfer between the high and low potential chains becomes uncoordinated:

      • Under aerobic conditions, b-heme reduction is enhanced because their oxidation slows ~20-fold

      • Cytochrome-f reduction slows ~10-fold

      • Under anoxic conditions, a redox-inactive low-potential chain causes a ~25-fold slowdown in the high-potential chain

    These findings demonstrate that seemingly minor structural elements play crucial roles in maintaining proper electron flow dynamics.

  • What methods are used to investigate the movement of the petC Rieske iron-sulfur domain during electron transfer?

    The petC Rieske domain undergoes conformational changes during electron transfer that can be studied using:

    1. Time-resolved spectroscopy: Tracks electron movement through the complex components with microsecond to millisecond resolution

    2. EPR spectroscopy: Provides information about the redox state and environment of the iron-sulfur cluster

    3. Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions with altered solvent accessibility during conformational changes

    4. Molecular dynamics simulations: Models domain movements based on crystal structures

    5. Cryo-EM classification: Captures different conformational states of the complex

    Research has shown that the hydrophilic domain of petC moves toward the PetA subunit during electron transfer from the Rieske iron-sulfur cluster to heme f, making this motion essential for photosynthetic electron transport .

  • How does the plastoquinone pathway interact with petC in the cytochrome b6-f complex?

    High-resolution cryo-EM structures have revealed unexpected details about plastoquinone interactions with the complex:

    • Three plastoquinones line up head-to-tail near the Qp site in each monomer, indicating the existence of a channel

    • This arrangement suggests quinones flow through the cytochrome b6-f complex in one direction, transiently exposing the redox-active ring during catalysis

    • This "one-way traffic model" explains efficient quinol oxidation during photosynthesis

    The petC subunit's iron-sulfur cluster accepts electrons from plastoquinol at the Qp site, making it a critical component in this electron transfer pathway. The proximity of petC to the plastoquinone channel directly impacts the efficiency of electron extraction from plastoquinol molecules .

  • What role does petC play in regulating the balance between linear and cyclic electron flow?

    The petC subunit contributes to regulating electron flow pathways through several mechanisms:

    • Cyclic electron flow (CEF) between Photosystem I and the cytochrome b6-f complex produces extra ATP when cellular demand for ATP exceeds that for NADPH

    • The cytochrome b6-f complex regulates both linear electron flow (LEF) and CEF via photosynthetic control - a pH-dependent slowdown of plastoquinol oxidation at the lumenal site where petC operates

    • Mutations in petC that affect its sensitivity to lumen pH (such as PETC-P171L) directly impact this regulatory mechanism

    • Under conditions favoring CEF, electrons donated by PSI to the NADPH/ferredoxin pool could be reinjected into the plastoquinone pool at the Qn site, potentially operating according to the original Mitchell Q cycle

    These regulatory functions highlight petC's central role not just in electron transfer but in maintaining appropriate ATP:NADPH ratios for plant metabolism under changing environmental conditions.

  • What are the challenges in reconstituting functional cytochrome b6-f complexes with recombinant components?

    Reconstitution of functional cytochrome b6-f complexes faces several technical challenges:

    • The complex contains multiple cofactors (hemes, iron-sulfur clusters) that must be properly incorporated

    • Assembly requires coordinated expression of both nuclear-encoded (petC) and chloroplast-encoded components

    • Proper membrane insertion and folding is essential for function

    • The complex exists as a homodimer with specific interactions between subunits

    Studies of mutants with impaired cytochrome b6-f assembly provide insights into these challenges. For example, in a mutant of Lemna perpusilla that contained less than 1% of the normal level of the four protein subunits:

    • Chloroplast genes for cytochrome f, cytochrome b6, and subunit IV (petA, petB, and petD) were transcribed normally

    • The level of translationally active mRNA for the nuclear-encoded Rieske Fe-S protein (petC) was reduced by >100-fold

    • Subunit IV showed a 10-fold higher rate of protein turnover

    These results indicate that petC plays a key role in the assembly and stability of the entire complex, and successful reconstitution requires careful coordination of all components.

Research Applications and Future Directions

  • How can recombinant petC be used to study the effects of post-translational modifications on cytochrome b6-f function?

    Recombinant petC provides an excellent platform for studying post-translational modifications:

    • Site-directed mutagenesis can replace specific residues that undergo modification

    • In vitro modification systems can be used to add specific modifications under controlled conditions

    • Activity assays comparing modified and unmodified versions can quantify functional effects

    Recent research has demonstrated that phosphorylation of the related PetD subunit at residue T4 creates a regulatory feedback loop affecting STT7 kinase activity and state transitions . Similar approaches could reveal how modifications of petC influence electron transfer rates, protein-protein interactions, or complex stability.

  • What new insights have high-resolution structural studies provided about petC function?

    Recent high-resolution cryo-EM structures have revealed several unexpected features:

    • The structure of spinach cytochrome b6f at 2.7 Å resolution revealed petC interacting with plastocyanin, showing specific contact points that facilitate electron transfer

    • Structures at 2.1 Å resolution showed detailed side chain conformations including the highly conserved Pro-Glu-Trp-Tyr (PEWY) sequence in the Qp site

    • An additional peptide of the thylakoid soluble phosphoprotein (TSP9) was found bound within a groove on the stromal side, interacting with several subunits including components near petC

    • The arrangement of plastoquinones in a channel suggests a one-way traffic model for efficient quinol oxidation

    These structural insights provide new mechanistic understanding of how petC contributes to electron transfer and complex regulation.

  • How does the structure of petC from thermophilic organisms differ from mesophilic counterparts, and what insights does this provide for protein engineering?

    Studies of petC from the thermophilic cyanobacterium Thermosynechococcus elongatus BP-1 have revealed:

    • The protein structure unexpectedly showed higher similarity to eukaryotic PetCs than to other prokaryotic PetCs

    • The positions of internal water molecules also resembled eukaryotic rather than prokaryotic patterns

    • A deep pocket on the petC surface oriented toward the membrane was identified, with surface properties suggesting a binding site for a hydrophobic compound

    • Complete conservation of the pocket-forming residues in all known petC sequences indicates functional importance

    These findings provide important insights for protein engineering efforts focused on enhancing stability or optimizing electron transfer properties for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.