Recombinant Cytochrome b6-f complex subunit 4, chloroplastic (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4, chloroplastic; 17 kDa polypeptide; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-173
Protein Length
Full Length of Mature Protein
Species
Euglena gracilis
Target Names
petD
Target Protein Sequence
NVMKKPDLSDPKLRAKLAKGMGRNYYGEPAWPNDLLYMFPVCILGTFAAIVGLAVMQPTP TGEPANPFATPLEILPEWYFFPTFNLLRVIPNKLLGVLSMAAVPAGLITVPFIENVNKFQ NPFRRPVATSVFLLGTVVAIWLGIGATLPIDKAISLGFW
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what is the functional role of subunit 4 (petD)?

The cytochrome b6-f complex occupies a central position in the photosynthetic electron transport chain, connecting photosystems I and II. It oxidizes plastoquinol (PQH2) and contributes to the transmembrane proton gradient necessary for ATP synthesis. The complex contains eight tightly bound subunits per monomer in cyanobacteria (MW = 108,500) and nine in plant chloroplasts .

Subunit IV (petD) is one of the four major subunits of the cytochrome b6-f complex. It plays crucial roles in:

  • Formation of the quinone binding sites

  • Maintenance of the structural integrity of the complex

  • Regulation of state transitions through interaction with the Stt7 kinase

  • Electron transfer within the complex

The petD gene is chloroplast-encoded and assembles with other subunits including cytochrome f (petA), cytochrome b6 (petB), and the Rieske iron-sulfur protein to form the functional complex .

What experimental approaches are used to study petD function?

Several complementary approaches are employed to investigate petD function:

Experimental ApproachApplicationAdvantagesLimitations
Random mutagenesisIdentification of functional domainsUnbiased screening of multiple variantsHigher rates of non-functional variants
Site-directed mutagenesisTesting specific amino acid functionsPrecise targeting of hypothesized residuesRequires prior knowledge of important sites
Deletion mutantsUnderstanding assembly processesReveals dependency relationshipsMay disrupt multiple functions
Chloroplast transformationComplementation of mutantsAllows in vivo study of modified proteinsTechnically challenging
Phosphorylation analysesStudy of regulatory mechanismsReveals post-translational modificationsMay require specialized detection methods

Random mutagenesis using error-prone PCR has been particularly informative. For example, researchers targeted a ~300-bp fragment of petD corresponding to ~100 amino acids, generating approximately 1,200 random mutants with an average of ≥2 mutations per variant .

How are mutants of the petD gene created and screened for functional studies?

Creation and screening of petD mutants involves a multi-step process:

  • Design of mutagenesis strategy: Researchers identify target regions within petD, such as the region from the PEWY motif to the C-terminal, comprising helices F and G .

  • Random mutagenesis by error-prone PCR: This creates a library of petD variants with random mutations. The mutation rate can be adjusted based on research needs - higher rates (e.g., 3.5 mutations/300 bp) enrich transformation plates with potential mutant clones .

  • Reconstruction into plasmids: Mutated fragments are incorporated into plasmids containing selection markers (e.g., aadA cassette conferring spectinomycin resistance) .

  • Chloroplast transformation: A host strain lacking petD (ΔpetD) is transformed with the plasmid library. Homologous recombination replaces the native locus with the mutated variant .

  • Selection of transformants: Transformants are selected using appropriate antibiotics.

  • Screening for phenotypes: Transformed strains are screened for impaired functions, such as defective state transitions, using techniques like chlorophyll fluorescence imaging .

  • Sequencing of variants: The petD gene is sequenced to identify specific mutations responsible for the observed phenotypes .

Which regions of petD are critical for cytochrome b6-f complex function?

Several regions of petD have been identified as functionally important:

  • Stromal loop linking helices F and G: Residues Asn122, Tyr124, and Arg125 are crucial for state transitions. Mutations in these residues can block state transitions while maintaining electron transfer capability .

  • N-terminal domain: The N-terminal region is essential for cytochrome b6-f function. Deletion of five N-terminal amino acids disrupts both STT7 activity and electron transfer, highlighting its critical role in complex function .

  • Phosphorylation site at T4: Phosphorylation at threonine 4 by the STT7 kinase regulates state transitions. The phosphomimic mutation T4E inhibits STT7 kinase activity, revealing a feedback mechanism regulating phosphorylation .

  • PEWY motif region: This highly conserved region is involved in plastoquinol oxidation at the Qo site .

  • C-terminal region: Interactions between the C-terminus of petD and other subunits (particularly cytochrome b6) are essential for proper assembly and stability of the complex .

How do mutations in petD affect state transitions in photosynthetic organisms?

State transitions redistribute energy input between photosystems I and II to optimize photosynthetic efficiency. The process involves:

  • Reduction of the plastoquinone pool

  • Activation of the Stt7 kinase by the cytochrome b6-f complex

  • Phosphorylation of light-harvesting complexes II (LHCII)

  • Migration of phosphorylated LHCII between photosystems

Research has shown that specific mutations in petD can disrupt state transitions:

  • Mutations in the stromal loop (Asn122, Tyr124, Arg125): These residues are crucial for Stt7 kinase activation. Mutations here can block state transitions without affecting electron transport capability .

  • Phosphorylation site mutations: The phosphomimic mutation T4E inhibits STT7 kinase activity, resulting in a strain locked in State 1 .

  • N-terminal truncations: Deletion of five N-terminal amino acids inhibits STT7 activity and disrupts electron transfer .

Experimental evidence shows that the phosphorylation cascade involves a complex interplay between petD and STT7:

  • Highly phosphorylated forms of STT7 accumulate transiently after reduction of the plastoquinone pool

  • These forms represent the active state of the protein kinase

  • Phosphorylation of LHCII targets is favored at the expense of the protein kinase

  • Migration of LHCII toward PSI is the limiting step for state transitions

What is the relationship between petD and the Stt7 kinase in regulating state transitions?

The interaction between petD and the Stt7 kinase represents a crucial regulatory mechanism in photosynthesis:

  • Direct interaction: In vitro reconstitution experiments with purified cytochrome b6-f and recombinant Stt7 kinase domain demonstrate that the cytochrome b6-f complex enhances Stt7 autophosphorylation .

  • Role of Arg125: This residue in the stromal loop of petD is directly involved in activating Stt7. Mutation of this residue impairs Stt7 function .

  • Feedback regulation: Phosphorylation of petD at threonine 4 by Stt7 establishes a feedback loop that temporarily reduces STT7-dependent phosphorylation. This coincides with increasing PSBD T2 PSII core phosphorylation, balancing state transitions with other processes .

  • Structural basis: The peripheral stromal structure of the cytochrome b6-f complex, previously without a reported function, has been shown to participate in direct interaction with Stt7 on the stromal side of the membrane .

The mechanism involves:

  • Reduction of the plastoquinone pool

  • PQH2 binding at the lumenal Qo site

  • Signal transmission across the membrane to the stromal domain

  • Activation of the Stt7 kinase domain

  • Phosphorylation of LHCII proteins

How are electron transfer rates measured in petD mutants?

Electron transfer measurements in petD mutants require sophisticated biophysical techniques:

  • Electrochromic shift measurements: The transmembrane electrogenic phase of electron transfer between hemes bL and bH (occurring after quinol oxidation at the Qo site) is measured as an electrochromic shift of carotenoids, giving an absorbance increase at 520 nm .

  • Redox kinetics of cytochrome components:

    • Cytochrome f reduction kinetics can be monitored to assess electron flow through the high-potential chain

    • b-heme oxidation/reduction rates provide information about the low-potential chain

    • Comparisons between aerobic and anoxic conditions reveal functional differences in electron transfer pathways

  • Fluorescence measurements:

    • 77K fluorescence emission spectroscopy is used to assess antenna redistribution between PSI and PSII after cells are shifted to either State 1 or State 2 conditions

    • Room temperature fluorescence measurements evaluate electron transport rates and photosystem efficiency

For example, in the study of the petD N-terminal truncation mutant (ΔN), researchers observed that a redox-inactive low-potential chain caused a ~25-fold slowdown in the high-potential chain, as reflected in cytochrome-f reduction, explaining the diminished electron transport rate and enhanced P700 donor side limitation .

What approaches are used to analyze the assembly and stability of recombinant petD in the cytochrome b6-f complex?

Researchers employ multiple complementary techniques to analyze assembly and stability:

  • Western blotting analysis: Detection of subunit accumulation using specific antibodies against cytochrome b6-f components .

  • Pulse-labeling and pulse-chase experiments: These techniques allow researchers to compare cellular accumulation, rates of synthesis, and turnover of cytochrome b6-f subunits in various mutant strains .

  • Proteomic analysis: Mass spectrometry-based approaches quantify the levels of petD and other core cytochrome b6-f subunits in wild-type and mutant strains .

  • Purification of the complex: Histidine-tagged versions (e.g., 6-His tag on cytochrome f) facilitate purification of the complex and assessment of its composition .

  • Electrophoretic mobility analysis: Small differences in migration profiles of subunit IV (17.4-kDa) can be attributed to changes in peptide mobility induced by single-point mutations .

Key findings from these analyses include:

  • The rates of synthesis of cytochrome b6 and subunit IV are independent of the presence of other subunits

  • The stabilization of these subunits in thylakoid membranes is a concerted process

  • There is a marked dependence of subunit IV stability on the presence of cytochrome b6

  • Mature cytochrome f remains stable in the absence of either subunit IV or cytochrome b6, but its rate of synthesis is severely decreased under these conditions

What mutagenesis strategies have proven most effective for studying petD function?

Based on the literature, several mutagenesis strategies have yielded significant insights:

StrategyApplicationNotable FindingsReference
Random mutagenesisIdentifying functional domainsResidues Asn122, Tyr124, and Arg125 in the stromal loop are crucial for state transitions
Site-directed mutagenesisTesting specific residuesPhosphomimic mutation T4E inhibits STT7 kinase activity
Deletion mutagenesisProbing domain functionN-terminal truncation disrupts both STT7 activity and electron transfer
Targeted mutagenesis of conserved motifsStructure-function studiesMutations in PEWY motif affect quinone binding
Combined mutationsInvestigating compensatory effectsDouble mutations can partially restore function lost in single mutations

Random mutagenesis with chloroplast transformation has proven particularly effective. For example, in one study researchers:

  • Used error-prone PCR to target the petD sequence from the PEWY motif to the C-terminal

  • Generated a mutation library with approximately 2,000 transformants

  • Screened for impaired state transitions using chlorophyll fluorescence imaging

  • Identified specific residues crucial for cytochrome b6-f function

This approach is advantageous for proteins like petD where functional domains may not be obvious from sequence analysis alone.

How does the structure-function relationship of petD contribute to understanding photosynthetic electron transport?

The structure-function relationship of petD provides critical insights into photosynthetic electron transport:

  • Quinone binding sites: petD contributes to the formation of both Qo and Qi sites, which are essential for the Q-cycle mechanism. Mutations in these regions affect electron transport efficiency .

  • Membrane topology: petD contains multiple transmembrane helices connected by loops. The stromal loop linking helices F and G interacts with the Stt7 kinase, connecting redox sensing to state transitions .

  • Inter-subunit interactions: petD forms a salt bridge with cytochrome b6 (PetB), which is essential for complex assembly. Disruption of this interaction leads to degradation by the FTSH protease .

  • Prosthetic group coordination: The N-terminal region of petD plays a role in coordinating heme groups, particularly heme ci, which is involved in cyclic electron flow .

  • Regulatory domains: Phosphorylation sites in petD (particularly T4) establish a feedback regulation system for state transitions .

These structural features enable the cytochrome b6-f complex to serve as both an electron transport component and a redox sensor that initiates regulatory responses to changing environmental conditions. Understanding these relationships helps explain how photosynthetic organisms optimize energy capture and utilization under varying light conditions.

How are advanced imaging and computational approaches enhancing petD research?

Recent advances in imaging and computational methods have revolutionized petD research:

  • Surface-based analysis of PET data: Fully automatic pipelines combine tools from FreeSurfer and PETPVC to analyze PET data on the cortical surface, enabling more sophisticated visualization and analysis .

  • Machine learning integration: Machine learning algorithms enhance PET data analysis capabilities, enabling automated pattern recognition and more efficient data analysis. This approach is particularly valuable for:

    • Disease diagnosis and classification

    • Image segmentation

    • Quantitative analysis

    • Predictive health outcome modeling

  • Molecular dynamics simulations: Computational modeling of petD within the cytochrome b6-f complex helps predict:

    • Conformational changes during electron transport

    • Interaction sites with other proteins

    • Effects of mutations on complex stability and function

    • Proton and electron transfer pathways

  • Cryo-electron microscopy: High-resolution structural studies reveal detailed interactions between petD and other subunits in the cytochrome b6-f complex, particularly in capturing different conformational states during the catalytic cycle .

These advanced approaches are becoming essential for understanding the intricate structure-function relationships in petD and the cytochrome b6-f complex.

What are the key considerations for designing experiments involving petD mutations?

Designing effective experiments with petD mutations requires careful consideration of multiple factors:

  • Experimental purpose definition: Determine whether the study is exploratory (identifying new functional domains) or confirmatory (testing specific hypotheses about known regions) .

  • Selection of appropriate animal/organism model: The model organism must be appropriate for the research question. Chlamydomonas reinhardtii is often used for petD studies due to its:

    • Well-characterized chloroplast genome

    • Established transformation protocols

    • Ability to grow in both photosynthetic and non-photosynthetic conditions

  • Control group definition: Define necessary controls, including:

    • Wild-type strains (positive control)

    • ΔpetD strains (negative control)

    • Strains with mutations in other cytochrome b6-f subunits (specificity controls)

  • Randomization in experimental design: Randomly assign experimental units to treatment groups to reduce bias .

  • Sample size determination: Use power and sample size calculations to ensure sufficient statistical power to detect biologically meaningful effects .

  • Multi-parameter assessment: Evaluate mutations through multiple assays to distinguish between:

    • Assembly defects (protein accumulation, complex formation)

    • Electron transfer defects (redox kinetics, electrochromic shift)

    • Regulatory defects (state transitions, kinase activation)

  • Statistical analysis planning: Determine appropriate statistical methods before beginning the experiment .

Following these guidelines ensures scientifically valid and reproducible data when studying petD mutations.

How does research on petD contribute to our understanding of redox signaling in chloroplasts?

Research on petD has significantly advanced our understanding of redox signaling in chloroplasts:

  • Sensor function: The cytochrome b6-f complex acts as a sensor of the plastoquinone pool redox state, translating this information into regulatory responses .

  • Signal transduction across membranes: petD plays a key role in transmitting redox signals from the lumenal Qo site to the stromal domain, bridging the membrane barrier .

  • Kinase activation: The interaction between petD and the Stt7 kinase provides a direct mechanism for activating protein phosphorylation cascades in response to changes in electron transport .

  • Feedback regulation: The phosphorylation of petD T4 establishes a feedback loop that fine-tunes the state transition response, preventing excessive phosphorylation and maintaining system balance .

  • Control of gene expression: Defects in the cytochrome b6-f complex prevent light-induced expression of nuclear genes encoding plastid-localized enzymes involved in chlorophyll biosynthesis. This indicates that the complex, rather than the redox state of the plastoquinone pool alone, controls specific gene expression pathways .

  • Integration with other signaling pathways: petD-mediated state transitions interact with other regulatory mechanisms, including PSII core phosphorylation, cyclic electron flow, and non-photochemical quenching .

These findings demonstrate that petD contributes to a sophisticated redox signaling network that coordinates chloroplast and nuclear activities, optimizing photosynthetic performance under changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.