Recombinant Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Cytochrome b6-f complex subunit 4, also known as petD, is a crucial component of the cytochrome b6-f complex, which plays a pivotal role in the electron transport chain of photosynthesis in chloroplasts. This complex is essential for the process of oxygenic photosynthesis, facilitating the transfer of electrons and contributing to the generation of ATP and NADPH. The petD subunit, specifically, is involved in the structural integrity and functional regulation of the cytochrome b6-f complex.

Structure and Function of petD

The petD subunit is a 17 kDa polypeptide that corresponds to the C-terminal half of the cytochrome b subunit of the bc1 complex in mitochondria . It is one of the eight polypeptide subunits that constitute the cytochrome b6-f complex, along with petA (cytochrome f), petB (cytochrome b6), and petC (Rieske ISP) . The cytochrome b6-f complex is known for its role in quinone-dependent electron transport pathways and is integral to the cyclic electron transport pathway that involves photosystem I (PSI) .

SubunitMolecular Weight (kDa)Function
petA30.9Cytochrome f
petB24.7Cytochrome b6
petC19.3Rieske ISP
petD17.5Subunit IV, structural and regulatory roles

Research Findings on petD

Research on the petD subunit has highlighted its involvement in state transitions, which are crucial for adjusting the antenna sizes of photosystems I and II based on light conditions. Mutagenesis studies have identified specific residues in the stromal loop of petD that are essential for its interaction with the Stt7 kinase, which mediates state transitions . The interaction between petD and Stt7 kinase is pivotal for the regulation of light harvesting complexes through reversible phosphorylation, depending on the redox state of the plastoquinone pool .

3.1. Integration into the Thylakoid Membrane

The integration of petD into the thylakoid membrane is facilitated by the signal recognition particle (SRP) pathway, which is a post-translational mechanism. This process involves the interaction of petD with the SRP54 protein, which guides the insertion of petD into the membrane . The absence of SRP54 significantly impairs the integration of petD, highlighting the importance of this pathway for the proper localization of petD within the thylakoid membrane .

Recombinant Production of petD

Recombinant production of petD allows for the generation of this subunit in controlled environments, facilitating detailed structural and functional studies. Recombinant petD proteins are available for research purposes, such as the one derived from Euglena gracilis, which is stored in a Tris-based buffer with glycerol to maintain stability . The recombinant protein is crucial for biochemical assays and structural analyses aimed at understanding the precise role of petD in the cytochrome b6-f complex.

Recombinant petD Details
Species
Uniprot Number
Storage Buffer
Storage Conditions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-161
Protein Length
full length protein
Species
Synechococcus elongatus
Target Names
petD
Target Protein Sequence
MAKVLKKPDLTNPALRAKLKKGMGHNYYGEPAWPNDLLYIFPVVIMGTIALVIGLAVMDP AMVGEPADPFATPLEILPEWYLYPTFQIFRVVPNKLLGVLMNASIPLGLMLIPFIESVNK FQNPFRRPVAMTVFLFGTLVTLWLGIGAAFPLDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex subunit 4 (PetD) and what is its role in photosynthesis?

PetD, also known as subunit IV, is a ~17.4 kDa component of the cytochrome b6-f (cyt b6f) complex that plays a crucial role in the photosynthetic electron transport chain. The cyt b6f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and regulates state transitions in response to changing light conditions . PetD specifically contributes to the formation of the quinone binding pocket and provides structural stability to the complex.
In the architectural organization of the cyt b6f complex, PetD consists of three transmembrane helices (labeled E-F) that form a p-side saddle around the four-helix bundle of cytochrome b6 . This arrangement is critical for creating the quinone entry portal, which facilitates plastoquinone/plastoquinol exchange between the complex and the thylakoid membrane. The intricate positioning of PetD relative to other subunits enables efficient electron and proton transfer during photosynthetic processes.
Recent structural analyses have revealed that PetD contributes to both the stabilization of the complex and the formation of specific binding sites for regulatory molecules. The transmembrane arrangement of PetD helices creates a pathway for plastoquinone movement between the n-side and p-side electron exchange sites through an 11 × 12 Å portal at the roof of the inter-monomer cavity . This structural feature is essential for the complex's electron transfer function and distinguishes the b6f complex from related cytochrome complexes.

What are the most effective methods for generating recombinant PetD for structural and functional studies?

The production of recombinant PetD for research purposes typically involves a combination of molecular cloning, heterologous expression, and purification strategies tailored to maintain the functional integrity of this membrane protein. Based on recent successful approaches, chloroplast transformation in Chlamydomonas reinhardtii has emerged as a preferred method for studying PetD function in vivo .
For mutagenesis studies, the following methodology has proven effective: The petD sequence coding for the targeted region is first subjected to error-prone PCR or site-directed mutagenesis, and the variants are reconstructed into appropriate plasmids . After amplification in Escherichia coli, the plasmid library is used to transform the chloroplast genome of a ΔpetD host strain. Selection on photoautotrophic growth medium ensures that only functional variants are retained, as proper synthesis, folding, and assembly of PetD is essential for photosynthetic growth .
For biochemical characterization, the cytochrome b6f complex containing recombinant PetD can be purified using histidine-tagged cytochrome f (PetA) as a handle for affinity chromatography . This approach allows for the isolation of intact complexes for structural and functional analysis. Western blot analysis using specific antibodies, such as the commercially available anti-PetD polyclonal antibodies, can confirm the presence and integrity of the recombinant protein .

MethodApplicationAdvantagesLimitations
Chloroplast transformation in C. reinhardtiiIn vivo functional studiesNative environment, selection for functional variantsTime-consuming, specialized equipment needed
E. coli expressionBiochemical studies, antibody productionHigh yield, rapid expressionMay lack post-translational modifications
Biolistic transformationGeneration of mutant strainsEffective for chloroplast genome targetingRequires specialized delivery system
Random mutagenesis with photoautotrophic selectionStructure-function studiesUnbiased approach to identify critical residuesLimited control over mutation position

How can researchers verify the successful incorporation of recombinant PetD into the cytochrome b6f complex?

Verification of recombinant PetD incorporation into the cytochrome b6f complex requires multiple complementary approaches to confirm both the presence of the protein and its functional integration. The most definitive methods combine biochemical analysis with functional assays that assess the electron transfer capabilities of the complex.
Biochemical verification typically begins with isolation of thylakoid membranes followed by differential detergent solubilization and purification of the cytochrome b6f complex . SDS-PAGE analysis reveals the characteristic ~17.4 kDa band corresponding to PetD, which can be confirmed by immunoblotting using specific antibodies . Mass spectrometry analysis provides definitive identification and can detect any post-translational modifications or truncations .
Functional integration can be assessed through spectroscopic methods that directly measure electron transfer rates through the complex. The transmembrane electrogenic phase of electron transfer between hemes bL and bH can be measured as an electrochromic shift of carotenoids (absorbance increase at 520 nm) . Additionally, cytochrome f reduction kinetics provide a direct measure of the high-potential electron transfer chain activity .
For a comprehensive assessment, researchers should also evaluate the accumulation of other complex subunits, as proper PetD incorporation is often required for stable assembly of the entire complex. For instance, in the absence of functional PetD, the synthesis of cytochrome f is typically decreased, resulting in low accumulation levels . Restoration of normal cytochrome f levels can thus serve as an indirect indicator of successful PetD incorporation.

Which regions of the PetD protein are most critical for targeted mutagenesis studies?

Based on recent structural and functional analyses, several regions of the PetD protein have emerged as particularly critical for targeted mutagenesis studies. These regions contribute directly to either the structural integrity of the cytochrome b6f complex or its functional activities in electron transport and signaling.
The N-terminal region of PetD has been identified as essential for cytochrome b6f function, with truncation studies demonstrating significant impairment of electron transfer when this region is removed . The exact amino acid sequence "MSVTKKPD" at the N-terminus appears to be particularly important, with mutations at the T4 position (to either alanine or glutamate) showing distinct phenotypes related to state transitions and electron transport rates .
The F helix of PetD contains conserved proline residues (positions 105 and 112 in cyanobacteria) that create a bend critical for maintaining the proper aperture of the quinone entry portal . Site-directed mutagenesis of these prolines to alanine has been shown to decrease the size of the portal and consequently reduce plastoquinol access to the high-potential electron acceptors, affecting the rate-limiting step of photosynthetic electron transport .
Additionally, the stromal region of PetD appears to be involved in the activation mechanism of the Stt7 kinase, which regulates state transitions . Random mutagenesis focusing on the region from the PEWY motif to the C-terminus, comprising helices F and G, has successfully identified residues that affect this signaling pathway, including positions 122 (Asn), 124 (Tyr), and 125 (Arg) .

What are the most informative spectroscopic techniques for assessing PetD mutant function in vivo?

Several spectroscopic techniques provide valuable insights into the functional consequences of PetD mutations in vivo, with each method illuminating different aspects of cytochrome b6f complex activity and its integration within the photosynthetic apparatus.
77K fluorescence emission spectroscopy represents a powerful tool for assessing state transitions, which are regulated processes that balance excitation energy distribution between photosystems I and II . By freezing samples in liquid nitrogen after exposure to conditions favoring either State 1 or State 2, researchers can measure the characteristic fluorescence emission peaks associated with PSI (far-red, ~720 nm) and PSII (red, ~685-695 nm). Changes in the relative amplitudes of these peaks reflect the redistribution of light-harvesting complexes between the photosystems, with impaired state transitions indicating disruptions in cytochrome b6f complex function .
Absorbance spectroscopy targeting specific cytochrome components provides direct insights into electron transfer kinetics. The oxidation-reduction of b-hemes can be monitored at 563 nm, while cytochrome f redox changes are typically measured at 554 nm . These measurements can be performed with high time resolution following light flashes, revealing the kinetics of electron transfer through different components of the complex.
Electrochromic shift measurements at 520 nm detect the transmembrane electric field generation associated with charge separation during electron transfer . This technique specifically measures the electrogenic phase of electron transfer between hemes bL and bH after quinol oxidation at the Qo site, providing information about the integrity of the electron transport chain within the complex.

How do mutations in PetD affect state transitions and cyclic electron flow?

Mutations in PetD can profoundly impact both state transitions and cyclic electron flow, two processes that are critically dependent on cytochrome b6f complex function. The specific effects depend on the location and nature of the mutations, providing insights into structure-function relationships within the complex.
State transitions, which involve the redistribution of light-harvesting complexes between PSI and PSII in response to changing light conditions, are particularly sensitive to PetD alterations. Studies with chimeric fusions of subunit IV and PetL have demonstrated that state transitions can be completely abolished while leaving the Q-cycle (linear electron transport) intact . This suggests that specific structural features of PetD, distinct from those required for basic electron transport, are essential for the signaling processes that trigger state transitions.
More recent work with N-terminal truncations of PetD has shown that removing the "MSVTKKPD" sequence significantly impairs both state transitions and electron transport rates . Under these conditions, cells are unable to properly adjust the excitation balance between photosystems, as evidenced by altered 77K fluorescence emission patterns. These findings indicate that the N-terminus of PetD plays a crucial role in both the structural integrity of the complex and its regulatory functions.
Cyclic electron flow around PSI, which generates ATP without producing NADPH, is also affected by PetD mutations. This pathway involves electron transfer from ferredoxin back to the cytochrome b6f complex, likely through the involvement of the unique heme cn . Alterations in PetD that disrupt the structure of the complex can affect this pathway, as demonstrated by studies showing that loss of other small subunits like PetN destabilizes the complex and renders cyclic electron transfer partially insensitive to cytochrome b6f inhibitors .

How does the interaction between PetD and auxiliary proteins contribute to cytochrome b6f complex assembly and stability?

The assembly and stability of the cytochrome b6f complex depend on specific interactions between PetD and various auxiliary proteins that act as assembly factors or regulators. These interactions represent an important frontier in understanding the biogenesis of photosynthetic complexes.
One significant interaction partner is DAC (Designated Assembly Chaperone), a nucleus-encoded auxiliary protein factor that specifically interacts with PetD during complex assembly . DAC is a thylakoid membrane protein with two predicted transmembrane domains that is conserved from cyanobacteria to vascular plants. Yeast two-hybrid and coimmunoprecipitation analyses have confirmed the specific interaction between DAC and PetD . In Arabidopsis dac mutants, there is a severe defect in cytochrome b6f complex accumulation, suggesting that DAC plays a crucial role in either the assembly or stabilization of the complex through its interaction with PetD.
In vivo chloroplast protein labeling experiments have revealed that in dac mutants, the labeling rates of PetD and cytochrome f proteins are greatly reduced, whereas cytochrome b6 labeling remains normal . This suggests that DAC specifically influences the incorporation of PetD into the complex, which then affects the stability of cytochrome f. Importantly, while DAC interacts with PetD, it is not an intrinsic component of the mature cytochrome b6f complex, indicating its role as a true assembly factor.
The assembly process appears to be initiated by the formation of a cytochrome b6-subunit IV core sub-complex in each monomer unit, defining the intra-membrane conserved central core of the complex . This suggests that the interaction between PetD and cytochrome b6 represents a critical early step in the assembly pathway, followed by the incorporation of other subunits.

What role does PetD play in transmembrane signaling associated with plastoquinol oxidation?

PetD plays a crucial role in transmembrane signaling processes that link plastoquinol oxidation to regulatory responses within the photosynthetic apparatus. This signaling function represents a unique property of the cytochrome b6f complex compared to related cytochrome complexes.
The dimeric structure of the cytochrome b6f complex is specifically involved in transmembrane signaling associated with p-side oxidation of plastoquinol . Within this context, PetD contributes to the formation of the quinone binding pocket and potentially to conformational changes that propagate signals across the membrane. Structure analysis of lipid binding sites in the cyanobacterial b6f complex has shown that the space occupied by the H transmembrane helix in the cytochrome b subunit of the bc1 complex is mostly filled by a lipid in the b6f crystal structure . It has been suggested that this space can potentially be filled by the domain of a transmembrane signaling protein during signaling events.
One well-documented signaling pathway involves the activation of the Stt7/STN7 kinase, which phosphorylates light-harvesting complex II proteins to initiate state transitions. In vitro reconstitution experiments with purified cytochrome b6f complex and recombinant Stt7 kinase domain have shown that the complex enhances Stt7 autophosphorylation . Mutagenesis studies targeting the stromal region of PetD have identified specific residues involved in this activation mechanism, suggesting that PetD serves as a platform for kinase interaction and activation in response to changes in plastoquinol oxidation.
Additionally, chimeric fusion studies between PetD and PetL have revealed that alterations to these subunits can specifically abolish state transitions while leaving the basic electron transport function (Q-cycle) intact . This provides strong evidence that PetD contains structural elements specifically dedicated to transmembrane signaling rather than just electron transport.

What are the latest findings regarding post-translational modifications of PetD?

Recent research has begun to uncover the importance of post-translational modifications (PTMs) in regulating PetD function within the cytochrome b6f complex. These modifications represent an additional layer of control over photosynthetic electron transport and signaling processes.
Although specific data on PetD modifications is still emerging, studies on the cytochrome b6f complex have identified several types of regulatory PTMs that likely affect PetD function. The formation of disulfide bridges has been implicated in redox regulation of the complex, with evidence suggesting that CSP41-RNA complexes (which interact with the photosynthetic apparatus) are regulated by the stromal redox state via post-translational modifications . Given the involvement of PetD in both electron transport and signaling, similar redox-sensitive modifications may regulate its activity.
Phosphorylation represents another important regulatory mechanism. While the Stt7/STN7 kinase is known to phosphorylate light-harvesting complexes during state transitions, there is growing evidence that components of the cytochrome b6f complex itself may be phosphorylated . This could create feedback regulation where the complex not only activates the kinase but is also subject to phosphorylation-dependent regulation.
Metal ion binding can also be considered a form of post-translational modification that affects protein function. Crystal structure analysis has identified specific metal binding sites in the cytochrome b6f complex, including a cadmium binding site (Cd2) for which Asp58 of PetD serves as one of the ligands . While cadmium is not a physiological ion, this finding suggests that similar binding sites for physiologically relevant ions like magnesium or calcium might exist and regulate complex activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.