Recombinant Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Cytochrome b6 (petB) is a genetically engineered form of the plastid-encoded protein that non-covalently binds two heme groups (b562 and b566) and facilitates electron transfer between Photosystem II and Photosystem I . It is integral to the Q-cycle, which generates a proton gradient for ATP synthesis . The recombinant form retains these functional properties, enabling in vitro studies of photosynthetic mechanisms .

Expression Systems

  • Escherichia coli: Widely used for high-yield production (e.g., 20 mg/L culture) .

  • Cell-Free Systems: Employed for transmembrane protein synthesis without cellular toxicity .

Purification Strategies

  • Affinity Chromatography: His-tagged variants enable single-step purification .

  • Detergent-Based Solubilization: Neutral detergents like Hecameg preserve native conformation .

Table 3: Notable Studies on Recombinant petB

Study FocusKey FindingReference
Heme BindingC-terminal modifications prevent heme cn attachment
RNA StabilityPrfB3 stabilizes petB transcripts under light stress
Cryo-EM StructurePetP auxiliary protein displaces PetG subunit in cyanobacteria

Challenges in Production

  • Complex Assembly: Requires auxiliary subunits (e.g., PetM, PetP) for functional maturation .

  • Post-Translational Modifications: Heme incorporation and disulfide bond formation necessitate optimized expression conditions .

Future Directions

  • High-Throughput Screening: Optimize expression systems for enhanced yield and stability .

  • Regulatory Mechanisms: Explore PetB’s role in cyclic electron flow and stress responses .

  • Biotechnological Applications: Engineer photosynthetic efficiency in crops using recombinant complexes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
petB; OtCpg00120; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Ostreococcus tauri
Target Names
petB
Target Protein Sequence
MSKVYNWFNERLEIQSIADDVTSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEVNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVILSVITVSFGVTGYSLPWDQVGYWAVKIVTGVPDAIPVIGGFVVELLRGSVGVGQPTL TRFYSLHTFVLPLLAAVFMLMHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI). It also participates in cyclic electron flow around PSI and state transitions.
Database Links

KEGG: ota:OstapCp12

STRING: 70448.Q0P3P0

Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b6 and what is its role in photosynthetic organisms?

Cytochrome b6 (encoded by the petB gene) is a critical component of the cytochrome b6f complex located in the thylakoid membrane of chloroplasts. This integral membrane protein has a molecular weight of approximately 24 kDa and plays a fundamental role in electron transport during photosynthesis . Unlike its mitochondrial counterpart (the cytochrome bc1 complex involved in respiration), the chloroplast petB gene is split into petB and petD genes, which appears to be an evolutionary adaptation to accommodate heme ci insertion .

The protein serves as a crucial link in the electron transport chain between photosystem II and photosystem I, contributing to both linear and cyclic electron flow. Additionally, the cytochrome b6f complex plays a regulatory role in state transitions, which optimize photosynthetic efficiency under changing light conditions.

How is the structure of Cytochrome b6 related to its function?

The structure of Cytochrome b6 includes multiple transmembrane domains and binding sites for heme groups, which are essential for its electron transport function. The C-terminal region of the protein forms a critical salt-bridge with subunit IV (suIV) that stabilizes the complex . This structural arrangement is crucial for proper complex assembly and function.

The covalent binding of heme ci to C35 of Cytochrome b6 via a thioether bond is a distinctive feature that differentiates it from mitochondrial and bacterial counterparts. This unique structural element is essential for the function of the plastoquinone reduction site (Qi) .

What are the recommended detection methods for Cytochrome b6 in experimental samples?

Several validated methods are available for detecting Cytochrome b6 in research samples:

  • Western blot analysis: Using specific antibodies against the N-terminal region of Cytochrome b6 at dilutions of 1:1000 to 1:5000 provides reliable detection . The expected molecular weight is 24 kDa.

  • Blue native PAGE (BN-PAGE): This technique allows analysis of intact protein complexes and can reveal associations between Cytochrome b6 and other components of the b6f complex .

  • Heme staining: TMBZ (tetramethylbenzamidine) peroxidase activity staining can be used to detect the heme groups associated with Cytochrome b6, providing additional confirmation of the presence of functionally intact protein .

  • Immunodetection in mutant backgrounds: Comparison with appropriate controls (including ΔpetB strains) allows for specific identification of the protein and assessment of accumulation levels .

What expression systems are suitable for recombinant production of Cytochrome b6?

Researchers have successfully used several expression systems for recombinant Cytochrome b6 production:

  • Chloroplast transformation: This homologous expression approach is particularly effective for photosynthetic proteins. Transformation can be achieved using gold particle bombardment of plasmid DNA (such as pWBA containing the petB gene) into appropriate host strains, followed by selection on media with antibiotics like spectinomycin .

  • E. coli expression systems: Although more challenging due to cofactor incorporation requirements, E. coli has been used successfully for expression of various cytochromes . Special consideration must be given to proper folding and heme incorporation.

  • Protease-deficient strains: For mutations that might destabilize the protein, expression in protease-deficient backgrounds (such as ftsh1-1 mutants) can improve accumulation of otherwise rapidly degraded variants .

What purification strategies yield functional Cytochrome b6 protein?

Successful purification of functional Cytochrome b6 typically involves:

  • Cell disruption and membrane fraction isolation

  • Solubilization with appropriate detergents

  • Chromatographic separation techniques

For recombinant versions with affinity tags, nickel affinity chromatography followed by detergent exchange via hydroxylapatite chromatography has proven effective for related cytochromes . The purified protein should be stored at -80°C until use to maintain functional integrity.

How do C-terminal modifications affect Cytochrome b6 assembly and function?

The C-terminal region of Cytochrome b6 is critical for proper protein function and complex assembly. Research has demonstrated that:

Table 1: Comparative Analysis of Wild-Type and Mutant Cytochrome b6 Properties

Strain/MutantPhotoautotrophic GrowthHeme ci BindingState Transition CapabilityPSII Quantum Yield (φPSII)FM'/FMProtein Accumulation
Wild-TypeNormalPresentNormalHighLowNormal
ΔpetBRequires acetateAbsentBlocked in State 1LowHighNone
R207Kb6SlowPresentNormalHighLowNormal
xL215b6SlowAbsentBlocked in State 1LowHighNormal (in ftsh1-1)
G216b6SlowAbsentBlocked in State 1LowHighNormal (in ftsh1-1)

What is the relationship between Cytochrome b6 and state transitions in photosynthesis?

The cytochrome b6f complex plays a central role in state transitions - a regulatory mechanism that balances excitation energy between photosystems I and II under changing light conditions:

  • The stromal region of the cytochrome b6f complex is intimately connected to the STT7 protein kinase through interactions with both subunit IV and the C-terminal portion of Cytochrome b6 .

  • This interaction facilitates the phosphorylation of light-harvesting complex II (LHCII) proteins, which subsequently migrate between photosystems to optimize energy distribution.

  • Mutations affecting the C-terminal region of Cytochrome b6 (particularly xL215b6 and G216b6) result in a high fluorescence phenotype indicative of being locked in State 1, demonstrating the critical role of this protein region in facilitating proper state transitions .

  • Strains with functional mutations in Cytochrome b6 show characteristic fluorescence patterns, with high FM'/FM ratios that serve as reliable indicators of state transition capabilities .

How does heme ci incorporation influence Cytochrome b6 functionality?

Heme ci is a unique cofactor in Cytochrome b6 that significantly impacts its function:

  • Unlike standard b-type hemes, heme ci forms a covalent thioether bond with C35 of Cytochrome b6 .

  • This covalent attachment is essential for proper function of the plastoquinone reduction site (Qi) .

  • Mutations that disrupt the C-terminal region of Cytochrome b6 prevent proper heme ci binding, as evidenced by the absence of heme staining in otherwise detectable protein .

  • The fragmentation of bacterial and mitochondrial cytochrome b into separate petB and petD genes in chloroplasts appears to be an evolutionary adaptation to accommodate heme ci insertion .

  • Proper heme ci ligation requires stabilization of a transient assembly complex (CCB2-4/CCB3/cyt b6), which is disrupted when the C-terminal "strap" between Cytochrome b6 and subunit IV is modified .

What are the recommended protocols for site-directed mutagenesis of the petB gene?

Successful site-directed mutagenesis of the petB gene requires careful planning and execution:

  • Plasmid preparation: Modify the petB gene in an appropriate vector (such as pWBA) that includes a selectable marker (e.g., aadA resistance cassette for spectinomycin selection) .

  • Transformation method: For chloroplast transformation, gold particle bombardment has proven effective. DNA is precipitated onto gold particles following established protocols (e.g., Seashell Technology S550d gold DNA protocol) .

  • Host strain selection: Consider using protease-deficient strains (e.g., ftsh1-1) when studying mutations that might destabilize the protein . This prevents rapid degradation of modified proteins.

  • Selection and homoplasmy: Transform cells on selective media (e.g., TAP with 150 μg/mL spectinomycin) and maintain selection pressure through multiple rounds of restreaking until homoplasmy is achieved (typically >3 months) .

  • Genotyping verification: Confirm successful transformation using PCR with mutation-specific primers. The "Chelex" method for DNA extraction from small samples is effective for screening multiple transformants .

What analytical methods are most informative for characterizing Cytochrome b6 mutants?

Multiple complementary analytical approaches provide comprehensive characterization:

  • Growth assays: Comparing growth on minimal versus acetate-containing media reveals photosynthetic competence .

  • Chlorophyll fluorescence measurements: Parameters such as PSII quantum yield (φPSII) and FM'/FM ratios provide insight into photosynthetic efficiency and state transition capabilities .

  • Protein accumulation analysis: Total protein extraction followed by SDS-PAGE and immunodetection using specific antibodies allows quantification of Cytochrome b6 and associated proteins .

  • Heme detection: TMBZ staining for peroxidase activity provides specific visualization of heme-containing proteins, allowing assessment of cofactor incorporation .

  • Blue native PAGE: Analysis of intact protein complexes can reveal assembly defects and protein-protein interactions .

How can researchers optimize antibody-based detection of Cytochrome b6?

For optimal immunodetection of Cytochrome b6:

  • Antibody selection: Anti-Cytochrome b6 antibodies targeting the N-terminal region (such as AS18 4169) have demonstrated high specificity across multiple species including A. thaliana, C. reinhardtii, and various other photosynthetic organisms .

  • Antibody preparation: Lyophilized antibodies should be reconstituted with sterile water and stored appropriately. Once reconstituted, aliquoting prevents damage from repeated freeze-thaw cycles .

  • Dilution optimization: For Western blot applications, dilutions between 1:1000 and 1:5000 typically provide optimal results .

  • Sample preparation: Brief centrifugation of antibody tubes before opening prevents loss of material that might adhere to the cap or tube walls .

  • Storage considerations: Lyophilized antibodies can be stored at -20°C for up to 3 years, while reconstituted antibodies remain stable at 4°C for several days to weeks .

Why might recombinant Cytochrome b6 fail to accumulate despite successful transformation?

Several factors can contribute to poor accumulation of recombinant Cytochrome b6:

  • Protein instability: Modifications, particularly to the C-terminal region, can destabilize the protein and trigger degradation pathways .

  • Protease activity: The ATP-dependent zinc metalloprotease FTSH specifically targets non-functional or improperly assembled Cytochrome b6f complexes. Using ftsh1-1 mutant backgrounds can circumvent this issue .

  • Incomplete homoplasmy: Chloroplasts contain multiple genome copies, and incomplete replacement with the transgenic version can result in mixed populations with reduced transgene expression. Extended selection (>3 months) may be necessary to achieve homoplasmy .

  • Assembly defects: Cytochrome b6 requires proper complex formation with other subunits. Mutations that disrupt these interactions can prevent stable accumulation of the protein despite normal expression levels .

  • Cofactor incorporation: Failure to properly incorporate heme groups can lead to structural instability and degradation of the protein .

What are the common challenges in functional analysis of Cytochrome b6 mutants?

Researchers studying Cytochrome b6 mutations frequently encounter these challenges:

  • Pleiotropic effects: Mutations affecting Cytochrome b6 often impact multiple aspects of photosynthesis, making it difficult to isolate specific functional relationships.

  • Growth conditions: Photosynthetic mutants often require careful optimization of light intensity, media composition, and growth temperature to achieve sufficient biomass for analysis .

  • Functional redundancy: Alternative electron transport pathways may partially compensate for defects, masking phenotypes in certain conditions.

  • Protein-protein interactions: Mutations may alter interactions with regulatory proteins like STT7 kinase without completely eliminating function, requiring sensitive assays to detect partial defects .

  • State transition analysis: Distinguishing between direct effects on the Cytochrome b6f complex and indirect effects on state transitions requires careful experimental design and interpretation .

How can researchers distinguish between assembly defects and functional defects in Cytochrome b6 mutants?

Differentiating between assembly and functional defects requires multiple analytical approaches:

  • Protein accumulation analysis: Compare total Cytochrome b6 levels between wild-type and mutant strains using immunoblotting to determine if the protein accumulates to normal levels .

  • Complex formation assessment: Use Blue native PAGE to evaluate intact complex formation rather than just individual subunit accumulation .

  • Heme incorporation analysis: TMBZ staining can reveal whether the protein incorporates heme groups properly, as seen in the distinctive difference between wild-type Cytochrome b6 (heme-positive) and the xL215b6 and G216b6 mutants (heme-negative despite protein accumulation) .

  • Functional assays: Measure parameters like PSII quantum yield (φPSII) and state transition capacity (FM'/FM ratios) to assess functional competence independent of protein accumulation .

  • Genetic complementation: Express wild-type protein in mutant backgrounds to determine if defects can be rescued, confirming that phenotypes result directly from the mutation rather than secondary effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.