Recombinant Cytochrome b (cob)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome b (cob) is a crucial component of the electron transport chain, specifically within the respiratory chain complex III, also known as the bc1 complex or ubiquinol-cytochrome c reductase . This complex is vital for energy production in eukaryotes and aerobic prokaryotes . Recombinant Cytochrome b refers to Cytochrome b produced using recombinant DNA technology, where the gene encoding Cytochrome b is expressed in a host organism such as E. coli .

Structure and Function

Cytochrome b contains two heme b molecules: one with low potential (bLb_L) and another with high potential (bHb_H) . These hemes are coordinated within a four-helix bundle by highly conserved histidine residues . In yeast, these residues are located in the second (H82 and H96) and fourth (H183 and H197) transmembrane domains . Together with cytochrome c and the Rieske Fe/S protein, cytochrome b participates in the Q cycle, which is central to the catalytic reactions of the bc1 complex .

Assembly and Hemylation

The assembly of cytochrome b into the bc1 complex is a complex process involving several intermediate stages and assembly factors . Cytochrome b assembles through four intermediates into the bc1 complex. Intermediate I consists of cytochrome b, Cbp4, and assembly factors Cbp3-Cbp6 . Intermediate II includes cytochrome b, Cbp4, Qcr7, and Qcr8. Further incorporation of nuclear-encoded subunits releases Cbp4 and allows the formation of the functional bc complex through intermediates III and IV .

Heme insertion, known as hemylation, is also an essential step in cytochrome b maturation. Research indicates that cytochrome b hemylation follows a specific order, with bLb_L being hemylated before bHb_H . This process is monitored by assembly factors, and its efficiency is linked to a feedback loop that regulates cytochrome b synthesis .

Mutations and Phenotypes

Mutations in the histidine residues that coordinate heme binding can disrupt cytochrome b function . For example, altering histidine residues at positions 183 or 197 (Cytb-H183T or Cytb-H197F) results in the loss of heme coordination and a respiratory-deficient phenotype . Cells expressing these mutated cytochrome b variants accumulate reduced amounts of the bc1 complex .

Cytochrome b as a Drug Target

Cytochrome b has been identified as a drug target in certain parasitic diseases . The Qi site of cytochrome b is a target for compounds with antikinetoplastid activity against Leishmania donovani and Trypanosoma cruzi . Inhibitors of cytochrome b can be rapidly identified through genetic and biochemical studies .

Recombinant Cytochrome b5 B/CYB5B Protein

Recombinant human cytochrome b5 B/CYB5B protein with a His-tag is expressed in HEK293 cells . Cytochrome b5 type B (CYB5B) belongs to the cytochrome b5 family and contains one cytochrome b5 heme-binding domain . It functions as an electron carrier for membrane-bound oxygenases .

Table 1: Properties of Recombinant Human Cytochrome b5 B/CYB5B Protein (His Tag)

PropertyValue
SynonymsCytochrome b5 outer mitochondrial membrane isoform, OMB5
SpeciesHuman
Expression HostHEK293 Cells
SequenceLys12-Cys118
AccessionAAH04373.1
Calculated Molecular Weight13.1 kDa
Observed Molecular Weight22 kDa
TagC-His
Purity> 95 % as determined by reducing SDS-PAGE.
Endotoxin< 1.0 EU per μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. Normally 5% - 8% trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cob; cytB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Aspergillus flavus
Target Names
cob
Target Protein Sequence
WGATVITNLMSAIPWIGQDIVEFIWGGFSVNNATLNRFFALHFLLPFVLAALALMHLIAM HDTVGSGNPLGISGNYDRLPFAPYFIFKDLVTIFIFFIVLSIFVFFMPNALGDSENYVMA NPMQTPPAIVPEWYLLPFYAILRSI
Uniprot No.

Target Background

Function
Recombinant Cytochrome b (cob) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is crucial for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b and what are its primary functions?

Cytochrome b is a transmembrane hemoprotein that functions as a critical component of respiratory chain complex III (also known as the bc1 complex or ubiquinol-cytochrome c reductase). It contains two heme components, cytochrome bL and cytochrome bH, and serves as the locus of both a quinol oxidizing site (Qo or Qz) and a quinone reducing site (Qi or Qc) . In the mitochondrion of eukaryotes and in aerobic prokaryotes, cytochrome b participates in electron transfer chains during oxidative phosphorylation, driving the production of ATP through the step-by-step transfer of electrons . It is the only component of complex III that is encoded by mitochondrial DNA (mtDNA) rather than nuclear DNA .

Why do researchers use recombinant Cytochrome b instead of native forms?

Researchers use recombinant cytochrome b because it allows for controlled experimental conditions, site-directed mutagenesis studies, and the production of sufficient quantities of protein for biochemical, biophysical, and structural characterization. Unlike native cytochrome b, which may be difficult to isolate in sufficient quantities from natural sources, recombinant systems enable the introduction of specific mutations to study structure-function relationships. For example, researchers have targeted highly conserved residues in the cytochrome b subunit of Rhodobacter sphaeroides (A52, H217, K251, and D252) for site-directed mutagenesis to investigate their role in the quinone reductase site function . Recombinant systems also allow for the addition of tags (such as His-tags) to facilitate purification and characterization .

What are the key structural features of Cytochrome b?

Cytochrome b contains several key structural features essential to its function:

  • Two heme prosthetic groups: cytochrome bL (low-potential) and cytochrome bH (high-potential), which participate in electron transfer .

  • Two functional sites: a quinol oxidizing site (Qo or Qz) and a quinone reducing site (Qi or Qc) .

  • Transmembrane domains that anchor the protein within the mitochondrial membrane or bacterial cell membrane .

  • Highly conserved amino acid residues (such as A52, H217, K251, and D252 in Rhodobacter sphaeroides) that are critical for function, particularly at the quinone reductase site .

  • A cytochrome b5 heme-binding domain in certain types of cytochrome b, such as cytochrome b5 type B (CYB5B) .

What model organisms are commonly used for Cytochrome b research?

Several model organisms are widely used in cytochrome b research, each offering distinct advantages:

  • Bacterial systems: Rhodobacter sphaeroides has been used for site-directed mutagenesis studies of cytochrome b . Escherichia coli, particularly the Rosetta-gami B(DE3) strain, has been developed as an effective expression system for recombinant cytochrome b proteins .

  • Yeast systems: Saccharomyces cerevisiae (baker's yeast) has been extensively used for isolating and manipulating both nuclear and mitochondrial mutants that affect the function and biogenesis of complex III . The yeast system is particularly valuable because researchers can introduce mutations in the cytochrome b gene using techniques like replacing the gene with ARG8m and then subsequently replacing ARG8m with mutated versions of cytochrome b .

  • Mammalian expression systems: These have been used to produce recombinant human cytochrome b5 B (CYB5B) with high fidelity to the native protein structure and post-translational modifications .

How do mutations in Cytochrome b affect electron transfer and what are the implications for mitochondrial diseases?

Mutations in cytochrome b can significantly impair electron transfer through complex III of the respiratory chain, with varying consequences depending on the specific mutation. Research has shown that mutations in highly conserved residues can selectively impair the rate of electron transfer from cytochrome bH to the Qc-site without affecting the reduction of cytochrome bH, suggesting a fully functional quinol oxidizing site but an impaired quinone reductase site .

Specifically, mutations in residues H217 and D252 (to alanine) in Rhodobacter sphaeroides resulted in an inability to grow photosynthetically, indicating a severe defect in the bc1 complex due to the lack of reoxidation of cytochrome bH by ubiquinone . In humans, mutations in the MT-CYB gene can cause mitochondrial complex III deficiency, which typically presents as muscle weakness (myopathy), pain, and exercise intolerance . More severe cases can involve multiple body systems, including the liver, kidneys, heart, and brain. Most MT-CYB mutations either change single amino acids in the cytochrome b protein or lead to an abnormally short protein, impairing the formation of complex III and severely reducing oxidative phosphorylation .

What are the kinetic differences between cytochrome bL and cytochrome bH in electron transfer, and how can these be experimentally determined?

The two heme centers in cytochrome b (bL and bH) exhibit distinct redox potentials and electron transfer kinetics. Research with purified recombinant duodenal cytochrome b has shown that ascorbate demonstrates marked kinetic selectivity for the high-potential heme center (bH) over the low-potential heme center (bL) . This difference in reactivity reflects the distinct roles of these heme centers in the electron transfer pathway.

To experimentally determine these kinetic differences, researchers typically employ:

  • Spectroscopic measurements: Monitoring the reduced minus oxidized difference spectrum to observe the reduction state of each heme center.

  • Stopped-flow kinetic analysis: Measuring the rate of electron transfer to each heme center upon addition of electron donors like ascorbate.

  • Site-directed mutagenesis: Creating mutations that specifically affect one heme center to isolate its properties.

  • Potentiometric titrations: Determining the redox potential of each heme center.

What are the most effective expression systems for different types of recombinant Cytochrome b, and what factors influence expression yield and functionality?

Different expression systems offer varying advantages for producing recombinant cytochrome b, with selection depending on research goals, required yield, and protein complexity:

  • E. coli Rosetta-gami B(DE3) system: This system has demonstrated high-yield production of functional recombinant human duodenal cytochrome b (Dcytb) with approximately 26.4 mg of purified, ascorbate-reducible cytochrome per liter of bacterial culture . Key factors contributing to successful expression include:

    • Addressing codon bias by using a strain designed for expressing proteins with rare codons

    • Optimizing conditions for disulfide bond formation

    • Using low-temperature (20°C) induction

    • Supplementing with heme and δ-aminolevulinic acid

    • Carefully selecting appropriate detergents (n-dodecyl-β-D-maltoside) for extraction and purification

  • Yeast expression systems: These can be particularly useful for studying mutations in cytochrome b in a eukaryotic context. The expression of recombinant mouse Cyb561d1 has been successfully achieved in yeast . For creating mutations in cytochrome b, researchers have developed sophisticated approaches in Saccharomyces cerevisiae, such as replacing the cytochrome b gene with ARG8m and then subsequently replacing ARG8m with mutated versions of cytochrome b .

  • Mammalian expression systems: These produce recombinant human cytochrome proteins with proper folding and post-translational modifications. For instance, recombinant Human Cytochrome b5 B/CYB5B has been produced with a C-terminal 6His tag in mammalian expression systems .

Factors influencing expression yield and functionality include codon optimization, growth conditions, induction protocol, selection of appropriate detergents for membrane protein solubilization, and purification techniques that preserve protein structure and function.

How do the structure-function relationships of Cytochrome b differ across species, and what implications does this have for using model organisms in research?

Cytochrome b is a highly conserved protein across species, but there are notable structural and functional differences that have important implications for research. The core catalytic functions of cytochrome b in electron transfer are preserved across species, but specific amino acid residues and regulatory mechanisms may vary:

These differences mean that researchers must carefully consider which model organism is most appropriate for their specific research questions. While bacterial and yeast systems offer advantages in terms of ease of genetic manipulation and protein expression, findings may not always directly translate to human systems. Comparative studies across species can provide valuable insights into both conserved functions and species-specific adaptations of cytochrome b.

What is the optimal protocol for purifying recombinant Cytochrome b while maintaining its functional integrity?

The following protocol has been demonstrated to effectively purify recombinant cytochrome b while preserving its functional integrity :

  • Membrane Fraction Isolation:

    • Harvest bacterial cells by centrifugation (6,000g for 10 minutes at 4°C)

    • Resuspend pellet in buffer (typically 0.1 M potassium phosphate, pH 7.5, with 5% glycerol)

    • Disrupt cells using sonication or French press

    • Remove cell debris by centrifugation (10,000g for 30 minutes at 4°C)

    • Isolate membrane fraction by ultracentrifugation (100,000g for 1 hour at 4°C)

  • Detergent Solubilization:

    • Resuspend membrane pellet in buffer containing 2% (w/v) n-dodecyl-β-D-maltoside (DM)

    • Add protease inhibitors to prevent degradation

    • Stir on ice for 1 hour, then continue stirring at 4°C overnight

    • Remove unextracted material by ultracentrifugation (100,000g for 1 hour at 4°C)

  • Affinity Chromatography:

    • For His-tagged recombinant cytochrome b, use cobalt affinity resin (such as TALON)

    • Prepare approximately 1 mL of resin suspension for each 3 mg of recombinant protein

    • Wash column with buffer containing 0.08% DM

    • Load solubilized protein extract onto the column

    • Wash with buffer containing low concentrations of imidazole to remove non-specifically bound proteins

    • Elute purified protein with buffer containing higher concentrations of imidazole

  • Post-Purification Processing:

    • Concentrate the purified protein using appropriate molecular weight cutoff concentrators

    • Perform buffer exchange to remove imidazole if necessary

    • Analyze purity by SDS-PAGE and verify functional integrity through spectroscopic analysis of ascorbate reducibility

This methodology typically yields highly purified, functionally active recombinant cytochrome b with preservation of its heme centers and electron transfer capabilities .

How can researchers effectively introduce site-directed mutations in Cytochrome b genes to study structure-function relationships?

Researchers can employ several approaches to introduce site-directed mutations in cytochrome b genes, depending on the experimental system:

  • For bacterial expression systems:

    • Design primers containing the desired mutation(s)

    • Perform PCR-based site-directed mutagenesis on the expression plasmid

    • Verify the mutation by DNA sequencing

    • Transform the mutant plasmid into an appropriate expression strain (e.g., E. coli Rosetta-gami B(DE3))

    • Express and purify the mutant protein for functional analysis

  • For yeast systems (particularly useful for studying mitochondrially-encoded cytochrome b):

    • Create a strain where the cytochrome b gene is replaced with a selectable marker (such as ARG8m)

    • Generate a plasmid containing the mutated cytochrome b gene

    • Transform yeast with the plasmid containing the mutated gene

    • Select for replacement of the marker with the mutated cytochrome b gene

    • Verify the mutation by PCR and DNA sequencing using appropriate primers

Specific example from research:
For creating mutations in the yeast cytochrome b gene, researchers have developed a method where ARG8 (a nuclear gene) replaces the mitochondrial cytochrome b gene, resulting in ARG8 expressed from the mitochondrial genome (ARG8m). Subsequently, this can be replaced with mutated versions of cytochrome b . This approach allows for the introduction of any type of mutation, including those that might lead to respiratory deficiency.

What spectroscopic and analytical techniques are most informative for characterizing recombinant Cytochrome b structure and function?

Several spectroscopic and analytical techniques are crucial for comprehensive characterization of recombinant cytochrome b:

  • UV-Visible Spectroscopy:

    • Reduced minus oxidized difference spectra to confirm the presence of functional heme centers

    • Determination of the α, β, and Soret bands characteristic of cytochrome b

    • Quantification of heme content and protein concentration to calculate the heme-to-protein ratio

  • Kinetic Measurements:

    • Stopped-flow spectroscopy to measure electron transfer rates

    • Analysis of ascorbate reduction kinetics to assess the functionality of high and low potential heme centers

  • Protein Structure Analysis:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Fluorescence spectroscopy to examine tertiary structure

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

  • Electrochemical Methods:

    • Potentiometric titrations to determine the redox potentials of the heme centers

    • Protein film voltammetry to study electron transfer properties

  • Functional Assays:

    • Quinol:cytochrome c oxidoreductase activity assays to measure complex III function

    • Inhibitor binding studies to characterize the quinone binding sites

    • Oxygen consumption measurements to assess respiratory chain activity in intact mitochondria

These techniques provide complementary information about the structural integrity and functional capabilities of recombinant cytochrome b proteins, allowing researchers to comprehensively characterize both wild-type and mutant variants .

What are the critical considerations for designing expression vectors for recombinant Cytochrome b?

Designing effective expression vectors for recombinant cytochrome b requires careful consideration of several factors:

  • Codon Optimization:

    • Optimize the cytochrome b coding sequence for the expression host to replace rare codons with synonymous high-frequency codons

    • For example, the CYBRD1 cDNA sequence was optimized for E. coli codon usage when creating an expression system for duodenal cytochrome b

  • Promoter Selection:

    • Choose appropriate promoters for controlled expression (e.g., T7 promoter for E. coli systems)

    • Consider inducible promoters to regulate expression timing and level

  • Fusion Tags:

    • Incorporate purification tags such as His-tags (typically 6 histidine residues) at either the N- or C-terminus

    • For cytochrome b proteins, C-terminal tags are often preferred to avoid interference with N-terminal signal sequences

  • Signal Sequences and Targeting Motifs:

    • Include appropriate signal sequences if necessary for membrane insertion or subcellular targeting

    • For mitochondrial proteins, consider including mitochondrial targeting sequences

  • Cloning Sites and Restriction Enzymes:

    • Design with convenient restriction sites for subcloning and manipulation

    • Example: The optimized Dcytb cDNA with a C-terminal His-tag was released by digesting with NdeI and XhoI and subcloned into a pre-digested pET43.1a vector

  • Vector Selection:

    • Choose vectors compatible with the expression host and containing appropriate selection markers

    • For E. coli expression, pET series vectors are commonly used

    • For yeast expression, vectors with suitable mitochondrial targeting sequences may be required

  • Expression Control Elements:

    • Include ribosome binding sites (for prokaryotic expression)

    • Consider 5' and 3' untranslated regions (UTRs) that may affect translation efficiency

By carefully addressing these considerations, researchers can significantly improve the yield and functionality of recombinant cytochrome b proteins in their chosen expression systems .

What are the common challenges in expressing functional recombinant Cytochrome b and how can they be overcome?

Recombinant expression of cytochrome b presents several challenges that researchers must navigate:

  • Low Expression Yield:

    • Challenge: Initial trials to express human Dcytb in E. coli BL21Star(DE3)/pT-groE strain were unsuccessful .

    • Solution: Switch to specialized strains like E. coli Rosetta-gami B(DE3) designed to address problems with codon bias, disulfide bond formation, and target plasmid stability .

  • Improper Heme Incorporation:

    • Challenge: Insufficient incorporation of heme groups into recombinant cytochrome b.

    • Solution: Supplement growth media with heme and δ-aminolevulinic acid (a heme precursor) and use low-temperature induction (20°C) to allow proper folding and heme incorporation .

  • Membrane Protein Solubilization:

    • Challenge: Difficulty extracting functional cytochrome b from membrane fractions.

    • Solution: Identify suitable detergents for extraction; n-dodecyl-β-D-maltoside (DM) has been found effective for extraction of recombinant Dcytb from the membrane fraction while maintaining protein solubility during purification .

  • Protein Misfolding:

    • Challenge: Recombinant cytochrome b may misfold due to rapid expression or lack of proper chaperones.

    • Solution: Use low-temperature induction, co-express with appropriate chaperones, or switch to a eukaryotic expression system for complex proteins.

  • Functional Verification:

    • Challenge: Ensuring that purified recombinant cytochrome b retains functional activity.

    • Solution: Perform spectroscopic and kinetic measurements to verify that the recombinant protein can be reduced by ascorbate and has the expected electron transfer properties .

Implementation of these solutions has allowed researchers to achieve at least a sevenfold improvement in yield of purified Dcytb over baculovirus-mediated expression systems, making the E. coli system particularly valuable for producing cytochrome for biophysical and structural studies .

How can researchers distinguish between proper and improper folding of recombinant Cytochrome b?

Distinguishing between properly and improperly folded recombinant cytochrome b is crucial for ensuring valid experimental results. Researchers can employ several complementary techniques:

  • Spectroscopic Analysis:

    • Properly folded cytochrome b exhibits characteristic UV-visible absorption spectra with distinct α, β, and Soret bands

    • The reduced minus oxidized difference spectrum should show expected peak positions and intensities

    • The heme-to-protein ratio should approach the theoretical value (e.g., a ratio of two for Dcytb)

  • Functional Assays:

    • Properly folded cytochrome b should retain reactivity with electron donors like ascorbate

    • Kinetic measurements can assess whether electron transfer rates are consistent with functional protein

    • Ascorbate reduction kinetics can reveal whether both high and low potential heme centers are functionally incorporated

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy can determine if the protein has the expected secondary structure composition

    • Size-exclusion chromatography can identify protein aggregation that may indicate misfolding

    • Thermal shift assays can assess protein stability, with properly folded proteins typically showing cooperative unfolding transitions

  • Detergent Sensitivity:

    • Properly folded membrane proteins generally maintain their structure and function in appropriate detergents

    • Testing different detergents and assessing function can help determine if the protein is correctly folded

  • Interaction with Known Binding Partners or Inhibitors:

    • Correctly folded cytochrome b should interact with known binding partners, substrates, or inhibitors with expected affinity

    • Inhibitors such as antimycin A, diuron, funiculosin, and HQNO can be used to test binding to the quinone reductase site

These analyses collectively provide a comprehensive assessment of recombinant cytochrome b folding status and functional integrity.

What strategies can be employed when recombinant Cytochrome b expression leads to a respiratory deficient phenotype?

When recombinant cytochrome b expression leads to a respiratory deficient phenotype, researchers can employ several strategic approaches:

  • Two-Step Gene Replacement Strategy:

    • An effective approach developed for yeast involves replacing the cytochrome b gene with a marker gene (such as ARG8m) and then replacing the marker with the mutated cytochrome b gene

    • This method allows for the introduction of mutations that may lead to respiratory deficiency, which would not be detected in direct screening approaches

  • Complementation Systems:

    • Express wild-type cytochrome b from a plasmid to complement the respiratory deficiency

    • This allows maintenance of strains with otherwise lethal mutations for study

  • Conditional Expression Systems:

    • Use inducible promoters to control the expression of mutant cytochrome b

    • This allows growth of cells under non-inducing conditions and then study of the effects when expression is induced

  • Selection Systems for Mitochondrial Transformation:

    • When working with yeast, utilize specialized selection systems

    • For example, if mutated COB DNA is non-functional in selection (as with the R79E mutation), researchers can identify synthetic ρ- by crossing with a mit- COX2 tester strain

    • The presence of a functional COX2 gene on a mitochondrial plasmid can be confirmed by crossover into the tester strain mitochondrial DNA

  • Fusion with Functional Domains:

    • Create fusion proteins that incorporate functional domains to support minimal respiratory function

    • This can allow study of otherwise lethal mutations

  • In vitro Reconstitution:

    • Express and purify the protein for in vitro functional studies

    • This bypasses the need for respiratory competence in the expression host

These strategies have enabled researchers to study cytochrome b mutations that would otherwise be difficult or impossible to maintain in living cells, providing valuable insights into structure-function relationships even for mutations that severely impair respiratory function .

How can researchers validate that recombinant Cytochrome b retains native electron transfer properties?

Validating that recombinant cytochrome b retains native electron transfer properties is essential for ensuring that experimental findings accurately reflect physiological function. Researchers can employ multiple complementary approaches:

  • Spectroscopic Analysis of Heme Centers:

    • Compare reduced minus oxidized difference spectra of recombinant and native proteins

    • Verify that the α, β, and Soret bands match in position and intensity

    • Confirm that the heme-to-protein ratio approaches the theoretical value (e.g., two hemes per protein for Dcytb)

  • Kinetic Measurements:

    • Measure electron transfer rates using stopped-flow spectroscopy

    • Compare the reactivity with electron donors (e.g., ascorbate) between recombinant and native proteins

    • Assess kinetic selectivity for high-potential versus low-potential heme centers

  • Functional Reconstitution:

    • Incorporate purified recombinant cytochrome b into proteoliposomes or nanodiscs

    • Measure electron transfer in the reconstituted system and compare to native membranes

  • Inhibitor Sensitivity Profiles:

    • Test the sensitivity to known inhibitors such as antimycin A, diuron, funiculosin, and HQNO

    • Compare inhibition constants (Ki values) between recombinant and native proteins

  • Mutagenesis Studies:

    • Introduce mutations known to affect electron transfer in the native protein

    • Verify that these mutations have similar effects in the recombinant protein

    • For example, mutations in H217 and D252 in Rhodobacter sphaeroides impair reoxidation of cytochrome bH by ubiquinone

  • Complex Formation Assays:

    • Assess the ability of recombinant cytochrome b to assemble into functional complexes (e.g., bc1 complex)

    • Compare complex activity between assemblies containing recombinant versus native cytochrome b

By applying these validation approaches, researchers can confidently use recombinant cytochrome b in their studies, knowing that the protein's electron transfer properties accurately reflect those of the native protein.

What emerging technologies might advance our understanding of Cytochrome b structure-function relationships?

Several emerging technologies show promise for deepening our understanding of cytochrome b structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Advanced cryo-EM techniques now allow near-atomic resolution of membrane protein structures

    • This could provide unprecedented insights into the conformational changes of cytochrome b during electron transfer

    • Visualization of cytochrome b within the entire respiratory complex III in different functional states

  • Time-Resolved Spectroscopy:

    • Ultrafast spectroscopic techniques can capture the dynamics of electron transfer in real-time

    • This allows observation of transient intermediates during the electron transfer process

    • Understanding the precise sequence and timing of electron movements through the heme centers

  • Molecular Dynamics Simulations:

    • Improved computational power enables simulation of cytochrome b within its native membrane environment

    • Modeling electron transfer pathways and energetics with quantum mechanical approaches

    • Predicting effects of mutations on protein structure and function

  • Single-Molecule Techniques:

    • Single-molecule fluorescence resonance energy transfer (FRET) to study conformational changes

    • Single-complex electron transfer measurements to capture heterogeneity in function

    • Correlating structural dynamics with electron transfer events

  • In-Cell NMR Spectroscopy:

    • Study cytochrome b structure and dynamics within living cells

    • Observe how the protein responds to changes in cellular environment and redox state

  • CRISPR-Based Mitochondrial DNA Editing:

    • Developing techniques for precise editing of mitochondrial DNA to introduce cytochrome b mutations

    • Creating better disease models for studying pathogenic mutations in MT-CYB

These technologies will likely provide deeper mechanistic insights into cytochrome b function and could lead to novel therapeutic approaches for mitochondrial diseases associated with cytochrome b dysfunction .

How might advances in recombinant Cytochrome b research contribute to understanding and treating mitochondrial diseases?

Advances in recombinant cytochrome b research hold significant potential for understanding and treating mitochondrial diseases through several pathways:

  • Improved Disease Modeling:

    • Recombinant expression systems allow researchers to study the effects of disease-causing mutations in cytochrome b

    • MT-CYB mutations are known to cause mitochondrial complex III deficiency, characterized by muscle weakness, exercise intolerance, and multi-organ involvement

    • By expressing and characterizing mutant proteins, researchers can understand the molecular mechanisms of disease

  • Therapeutic Protein Development:

    • Production of functional recombinant cytochrome b could potentially lead to protein replacement therapies

    • Developing delivery systems to target recombinant proteins to mitochondria in affected tissues

    • Engineering modified versions with enhanced stability or function for therapeutic applications

  • Drug Discovery Platforms:

    • Recombinant cytochrome b systems provide platforms for screening compounds that might rescue mutant protein function

    • Development of small molecules that could enhance residual complex III activity in patients with partial deficiencies

    • Identification of compounds that could bypass compromised steps in the electron transport chain

  • Personalized Medicine Approaches:

    • Characterizing the specific functional defects caused by different patient mutations

    • Tailoring treatment strategies based on the particular electron transfer defect

    • Developing patient-derived cellular models with specific cytochrome b mutations to test therapeutic approaches

  • Gene Therapy Development:

    • Insights from recombinant cytochrome b research could inform gene therapy approaches

    • Addressing challenges in delivering genetic material to mitochondria

    • Developing strategies to replace mutated MT-CYB with functional genes

These advances could significantly impact patients with mitochondrial diseases caused by cytochrome b dysfunction, potentially leading to the first effective treatments for these currently incurable conditions .

What are the potential applications of engineered recombinant Cytochrome b variants with modified electron transfer properties?

Engineered recombinant cytochrome b variants with modified electron transfer properties offer exciting possibilities for various applications:

  • Bioenergetic Enhancement:

    • Engineering cytochrome b variants with optimized electron transfer kinetics could potentially enhance mitochondrial energy production

    • These variants might improve cellular energy efficiency in biotechnological applications or compensate for deficiencies in disease states

  • Biosensors and Bioelectronics:

    • Modified cytochrome b proteins could serve as biological components in electrochemical biosensors

    • The electron transfer capabilities could be harnessed for developing sensitive detection systems for metabolites, toxins, or drugs

    • Integration into biofuel cells or bioelectronic devices

  • Synthetic Biology Applications:

    • Incorporation of engineered cytochrome b variants into synthetic electron transport chains

    • Creation of artificial photosynthetic systems with improved efficiency

    • Development of novel biocatalytic processes that utilize the electron transfer capabilities

  • Enhanced Bioremediation Systems:

    • Cytochrome b variants with modified substrate specificity could be used in engineered organisms for environmental applications

    • Potential for improved degradation of environmental pollutants through enhanced electron transfer to specific substrates

  • Disease Treatment Platforms:

    • Engineered variants could potentially bypass specific blocks in electron transport in mitochondrial diseases

    • Development of variants resistant to oxidative damage that could function in diseased tissues with high oxidative stress

  • Research Tools:

    • Creation of cytochrome b variants with site-specific probes or tags for investigating electron transfer mechanisms

    • Development of variants with altered inhibitor sensitivity for dissecting electron transport pathways

The successful high-yield production systems for recombinant cytochrome b proteins, such as the E. coli Rosetta-gami B(DE3) system, provide the necessary platform for exploring these potential applications by enabling the production of sufficient quantities of engineered variants for detailed characterization and testing .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.