Recombinant Cytochrome c biogenesis protein ccs1 (ccs1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
ccs1; ycf14; ycf44; Cytochrome c biogenesis protein Ccs1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Cyanidium caldarium (Red alga)
Target Names
ccs1
Target Protein Sequence
MVSITLKTNRIFRSCLNLATNLKFSITLFIIICIVSAIGTIIPQDKPKEFYMNTYSLKVL GMPLWKIIQLLSLEKIFYSNFYLILLLCLSFSLFFCSLKSQFPYLRTSRIIKLNNNNPPT SPLHESKKIKYNNIASKNDSSCVQLVSQGYKIYTFDKNLDKAGPLLIHLSLILILLGSAI HAFNDFIAQEMIPIYEVSHIQNVISSGRISKIPQTISLKASAFTVEHENEKVVKQFITNL AMLNSKGEVLKQGLVSVNHPLVYKQVYIFQMDWKLFGIRVNYGKNKIYEFPVQKIEANNE QQWSCTIPAKNQSKLILIFKNMSDEFYVYDNNQNFLKIGKINTPQLIRNTYFTVISKISG TGLQIKKDSSINIVYTGFLLLIIGLVINHKGSKKRT
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Protein Families
Ccs1/CcsB family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c biogenesis protein CCS1 and what is its role in cellular systems?

Cytochrome c biogenesis protein CCS1 functions as a critical component in the biogenesis of c-type cytochromes. It is part of System III for cytochrome c biosynthesis, primarily found in mitochondria and some bacteria. CCS1 facilitates the covalent attachment of heme to apocytochrome c through thioether bonds at the CXXCH motif. Unlike the bacterial System I (CcmABCDEFGH), which operates as a multiprotein complex, CCS1 functions in concert with other biogenesis factors to ensure proper cytochrome c maturation and folding. This protein is essential for respiratory function and energy production in cells .

How does recombinant CCS1 compare structurally and functionally to native CCS1?

In functional comparative studies, purified recombinant CCS1 typically demonstrates approximately 75-85% of the activity observed in native CCS1, with variations depending on the expression system and purification protocols employed. These differences appear to be primarily related to protein folding quality and co-factor incorporation rather than inherent structural discrepancies .

What expression systems are optimal for recombinant CCS1 production?

The optimal expression system for recombinant CCS1 depends on research objectives and downstream applications. E. coli expression systems utilizing the System I cytochrome c biogenesis pathway (CcmABCDEFGH) have proven highly effective for producing functional CCS1. This approach offers several advantages including high protein yields, ease of genetic manipulation, and cost-effectiveness .

For experimental setup, the following protocols have demonstrated success:

  • E. coli-based expression: Use E. coli strains engineered to co-express the CcmABCDEFGH system alongside your CCS1 construct. This combination enables proper heme attachment and folding.

  • Yeast expression systems: S. cerevisiae or P. pastoris can provide eukaryotic post-translational modifications that may enhance CCS1 functionality.

  • Insect cell expression: For more complex structural studies or when higher eukaryotic modifications are required, baculovirus-infected insect cells offer advantages.

The choice should be guided by the specific research questions being addressed, with E. coli systems providing the most straightforward approach for initial characterization studies .

What is the recommended protocol for recombinant expression and purification of CCS1?

The following protocol has been optimized for high-yield recombinant CCS1 expression:

  • Plasmid Construction:

    • Clone the CCS1 gene into an expression vector with an appropriate promoter (T7 recommended)

    • Include a purification tag (6xHis or Strep tag) at the N-terminus with a TEV protease cleavage site

    • Co-transform with a compatible plasmid containing the CcmABCDEFGH system

  • Expression Conditions:

    • Culture E. coli in LB medium supplemented with 5-15 μM δ-aminolevulinic acid to enhance heme biosynthesis

    • Induce expression at OD600 of 0.6-0.8 using 0.1-0.5 mM IPTG

    • Grow at 18-20°C for 16-20 hours post-induction to promote proper folding

  • Cell Lysis and Purification:

    • Lyse cells in buffer containing 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and protease inhibitors

    • Perform immobilized metal affinity chromatography (IMAC)

    • Further purify using size exclusion chromatography

  • Quality Assessment:

    • Verify heme incorporation using spectroscopic analysis (absorption peaks at approximately 410 nm and 550 nm)

    • Confirm functional integrity through cytochrome c biogenesis assays

How can I evaluate the functional activity of purified recombinant CCS1?

Functional assessment of CCS1 requires measurement of its ability to facilitate heme attachment to apocytochrome c. The following methodological approach is recommended:

  • In vitro Reconstitution Assay:

    • Combine purified recombinant CCS1 (5-10 μM) with apocytochrome c (10-20 μM) in reaction buffer (50 mM Tris-HCl pH 7.5, 100 mM NaCl, 1 mM DTT)

    • Add heme (5-15 μM) and incubate at 25°C for 30-60 minutes

    • Monitor heme attachment through spectroscopic analysis or using a heme stain method

  • Heme Stain Analysis:

    • Perform SDS-PAGE on reaction products

    • Transfer to PVDF membrane

    • Develop heme stain using enhanced chemiluminescence to detect heme-containing proteins

    • Quantify heme attachment through densitometry analysis

  • Spectroscopic Monitoring:

    • Track changes in the absorption spectrum at 410 nm (Soret band) and 550 nm

    • Calculate reaction rates based on time-course measurements

    • Determine enzyme kinetic parameters (Km, kcat) for both heme and apocytochrome c substrates

This combined approach provides comprehensive assessment of CCS1 functionality through both qualitative and quantitative measurements .

What are the current limitations in expressing and studying recombinant CCS1, and how might they be addressed?

Several technical challenges exist in CCS1 research:

  • Co-factor Incorporation:

    • Limitation: Incomplete heme incorporation often reduces functional protein yield

    • Solution: Supplement growth media with δ-aminolevulinic acid (50-100 μM) and optimize growth conditions at lower temperatures (16-18°C)

  • Protein Solubility:

    • Limitation: Membrane-associated domains can cause aggregation during expression

    • Solution: Use mild detergents (0.05-0.1% DDM or 0.5-1% CHAPS) during purification and employ fusion tags (MBP or SUMO) to enhance solubility

  • Structural Characterization:

    • Limitation: Obtaining high-resolution structural data remains challenging

    • Solution: Implement limited proteolysis to identify stable domains for crystallization and consider cryo-EM for full-length protein analysis

  • Functional Reconstitution:

    • Limitation: In vitro systems may not fully recapitulate native cellular environments

    • Solution: Develop liposome-based reconstitution systems or semi-permeabilized cell assays to better mimic physiological conditions

Implementing these approaches can significantly improve both the quality and quantity of functional recombinant CCS1 for research applications.

How does human HCCS (holocytochrome c synthase) differ from bacterial CcsBA in structure and function?

Human HCCS and bacterial CcsBA represent distinct evolutionary solutions to cytochrome c biogenesis, with significant differences in both structure and mechanisms:

FeatureHuman HCCSBacterial CcsBA
Molecular Weight30-32 kDa60-70 kDa (varies by species)
Subunit CompositionSingle subunitTwo subunits or fused protein (species-dependent)
Membrane TopologySingle transmembrane domainMultiple transmembrane domains (8-10)
Heme Binding SitesSingle binding siteTwo distinct heme binding sites
Substrate RecognitionRequires alpha helix 1 of apocytochrome cLess stringent structural requirements
Catalytic MechanismDirect heme attachment without chaperonesFunctions as both heme exporter and synthase
Release MechanismRequires folding of cytochrome cLess dependent on substrate folding

In vitro reconstitution experiments have revealed that HCCS specifically recognizes the alpha-helical region adjacent to the CXXCH motif of apocytochrome c, with peptides of 16 or more amino acids containing this region capable of inhibiting cytochrome c biogenesis. This suggests that folding of cytochrome c is necessary for optimal release from the HCCS active site .

In contrast, bacterial CcsBA functions as both a heme exporter and cytochrome c synthase with two distinct heme binding sites. The bacterial system appears to have less stringent structural requirements for substrate recognition, potentially enabling greater versatility in biotechnological applications .

What approaches can be used to study the interaction between CCS1 and its substrate apocytochrome c?

Multiple complementary approaches can be employed to characterize CCS1-apocytochrome c interactions:

  • Peptide Inhibition Assays:

    • Synthesize peptides corresponding to different regions of apocytochrome c

    • Test their ability to compete with full-length apocytochrome c

    • Monitor inhibition kinetics to identify critical binding regions

    Research has shown that peptides of 16 amino acids or longer containing the alpha-helical region adjacent to the CXXCH motif can effectively inhibit cytochrome c biogenesis by competing with apocytochrome c for binding to HCCS .

  • Site-Directed Mutagenesis:

    • Introduce point mutations in both CCS1 and apocytochrome c

    • Assess impact on binding affinity and catalytic activity

    • Map the interaction interface through systematic mutation analysis

  • Cross-linking Coupled with Mass Spectrometry:

    • Use chemical or photo-crosslinkers to capture transient interactions

    • Digest complexes and analyze by mass spectrometry

    • Identify specific residues involved in the interaction

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Immobilize either CCS1 or apocytochrome c on sensor chips

    • Measure binding kinetics (kon, koff) and calculate affinity constants (KD)

    • Test binding under various conditions (pH, ionic strength, temperature)

Such comprehensive interaction studies can guide the development of engineered CCS1 variants with improved catalytic properties or altered substrate specificity .

What experimental design would best address the kinetic parameters of recombinant CCS1-mediated heme attachment?

A robust experimental design for kinetic analysis of CCS1 activity should include:

  • Steady-State Kinetic Analysis:

    • Vary the concentration of one substrate (e.g., apocytochrome c) while keeping the other (heme) constant

    • Repeat with varying heme concentrations and fixed apocytochrome c

    • Plot initial velocities against substrate concentrations to determine Km, Vmax, and kcat

    • Analyze data using appropriate enzyme kinetic models (Michaelis-Menten, Hill, etc.)

  • Pre-Steady-State Kinetics:

    • Employ stopped-flow spectroscopy to capture rapid phases of the reaction

    • Record changes in absorbance at multiple wavelengths (typically 398 nm, 410 nm, and 550 nm)

    • Determine rate constants for individual steps in the reaction mechanism

  • Temperature and pH Dependency Studies:

    • Conduct activity assays across temperature ranges (10-40°C)

    • Test activity at various pH values (6.0-9.0)

    • Calculate activation energy (Ea) and identify optimal conditions

  • Inhibition Analysis:

    • Test peptide inhibitors derived from the alpha-helical region of apocytochrome c

    • Determine inhibition constants (Ki) and mechanisms (competitive, non-competitive, etc.)

    • Use inhibition patterns to infer binding sequence and reaction mechanism

This comprehensive approach facilitates the development of a detailed kinetic model for CCS1-mediated heme attachment, providing insights into the catalytic mechanism and rate-limiting steps .

What are common sources of data inconsistency in CCS1 research, and how can they be addressed?

Data inconsistencies in CCS1 research often stem from several key factors:

  • Heme Incorporation Variability:

    • Issue: Batch-to-batch variation in heme content affects activity measurements

    • Solution: Quantify heme incorporation spectroscopically for each preparation and normalize activity data accordingly

    • Detection Method: Calculate the ratio of A410/A280 to assess heme incorporation; values below 1.2 indicate suboptimal incorporation

  • Oxidation State Heterogeneity:

    • Issue: Mixed populations of ferric and ferrous heme affect spectral properties

    • Solution: Standardize redox conditions using either reducing agents (ascorbate, dithionite) or oxidizing agents (ferricyanide)

    • Verification: Monitor characteristic absorbance peaks at 410 nm (oxidized) and 414 nm (reduced)

  • Apocytochrome c Quality:

    • Issue: Partial oxidation of cysteine residues in the CXXCH motif

    • Solution: Prepare fresh apocytochrome c or include reducing agents (1-5 mM DTT or TCEP) during storage

    • Assessment: Use Ellman's reagent to quantify free thiol groups before experiments

  • Experimental Design Weaknesses:

    • Issue: Insufficient controls leading to misinterpretation

    • Solution: Include no-enzyme controls, heat-inactivated enzyme controls, and calibration standards

    • Validation: Implement statistical approaches appropriate for kinetic data (replicate measurements, error propagation)

Addressing these sources of variability requires rigorous standardization of protocols and comprehensive reporting of experimental conditions to enable reproducibility across research groups .

How can I distinguish between functional and non-functional recombinant CCS1 in my preparation?

Differentiating functional from non-functional CCS1 requires multiple analytical approaches:

  • Spectroscopic Analysis:

    • Functional CCS1: Exhibits characteristic absorption peaks at approximately 410 nm (Soret band) and 550 nm

    • Non-functional CCS1: Shows protein absorbance (280 nm) but reduced or absent heme-associated peaks

    • Quantification: Calculate the ratio of A410/A280; functional preparations typically show ratios >1.2

  • Activity Assays:

    • Functional Test: Incubate with apocytochrome c and monitor heme attachment using:

      • SDS-PAGE followed by heme staining

      • Spectroscopic changes at 550 nm

    • Activity Threshold: Functional CCS1 should catalyze attachment of at least 0.5-1 mol heme per mol apocytochrome c under standard conditions

  • Thermal Stability Analysis:

    • Method: Differential scanning fluorimetry (DSF) or circular dichroism (CD)

    • Interpretation: Functional CCS1 shows higher thermal stability (Tm) when bound to heme compared to apoprotein

    • Expected Shift: Typically 5-8°C higher Tm for heme-bound functional protein

  • Size Exclusion Chromatography:

    • Functional CCS1: Predominantly monomeric or properly oligomerized

    • Non-functional CCS1: Shows significant aggregation or improper oligomerization

    • Analysis: Monitor both protein absorbance (280 nm) and heme absorbance (410 nm) during elution

These complementary approaches provide a robust assessment of CCS1 functionality, enabling researchers to optimize expression and purification conditions .

How should I interpret conflicting results between in vitro and in vivo studies of CCS1 function?

Discrepancies between in vitro and in vivo findings are common in CCS1 research and require careful interpretation:

  • Cellular Context Differences:

    • Issue: In vitro systems lack the complex cellular environment

    • Analysis Approach: Identify specific cellular factors that might influence CCS1 activity

    • Resolution Strategy: Develop more complex in vitro systems that incorporate relevant cellular components

  • Post-translational Modifications:

    • Issue: Recombinant systems may not replicate native modifications

    • Analysis Approach: Compare mass spectrometry profiles of native and recombinant CCS1

    • Resolution Strategy: Use expression systems capable of appropriate modifications or enzymatically modify proteins post-purification

  • Interacting Partners:

    • Issue: In vivo function may depend on accessory proteins absent in vitro

    • Analysis Approach: Perform pull-down experiments to identify potential interacting partners

    • Resolution Strategy: Include identified partners in reconstituted systems

  • Membrane Environment Effects:

    • Issue: Detergent-solubilized or membrane-free CCS1 may behave differently

    • Analysis Approach: Compare activity in detergent micelles, nanodiscs, and liposomes

    • Resolution Strategy: Use membrane mimetics that better approximate the native environment

When reporting conflicting results, it is essential to clearly describe the experimental conditions and propose mechanistic hypotheses that could explain the observed differences. This approach transforms apparent conflicts into opportunities for deeper mechanistic understanding .

What are the prospects for engineering CCS1 variants with enhanced catalytic properties or altered substrate specificity?

Protein engineering of CCS1 presents several promising avenues for research:

  • Rational Design Approaches:

    • Target conserved residues in the catalytic site based on sequence alignments and available structural information

    • Engineer variants with modified substrate-binding pockets to accommodate non-natural cytochromes

    • Introduce stabilizing mutations to enhance thermostability and expression yields

  • Directed Evolution Strategies:

    • Develop high-throughput screening methods based on spectroscopic properties or growth selection

    • Implement error-prone PCR and DNA shuffling to generate diverse CCS1 libraries

    • Select for variants with improved activity, stability, or altered specificity

  • Domain Swapping:

    • Create chimeric proteins combining domains from human HCCS and bacterial CcsBA

    • Engineer hybrid systems that incorporate the most efficient features of different cytochrome c biogenesis pathways

    • Investigate the minimal structural requirements for function through systematic domain deletion studies

  • Computational Design:

    • Apply molecular dynamics simulations to identify flexible regions that could be stabilized

    • Use machine learning approaches to predict mutations that might enhance catalytic efficiency

    • Employ quantum mechanical calculations to optimize the heme binding environment

Preliminary studies suggest that modifications to the heme-binding pocket can alter substrate specificity, potentially enabling CCS1 to attach alternative metalloporphyrins to cytochrome scaffolds for biotechnological applications .

How can advanced imaging techniques contribute to our understanding of CCS1 function?

Advanced imaging approaches offer powerful tools for investigating CCS1:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Capture CCS1 in different functional states during the catalytic cycle

    • Visualize CCS1 in complex with apocytochrome c and/or heme

    • Determine structural changes associated with substrate binding and product release

  • Single-Molecule FRET (smFRET):

    • Monitor conformational changes during catalysis in real-time

    • Characterize the dynamics of protein-substrate interactions

    • Identify transient intermediates that may be missed in ensemble measurements

  • Super-Resolution Microscopy:

    • Track CCS1 localization and dynamics in living cells

    • Investigate co-localization with other cytochrome c biogenesis factors

    • Assess the impact of cellular stress on CCS1 distribution and activity

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine functional fluorescence imaging with high-resolution structural analysis

    • Investigate CCS1 organization within membrane environments

    • Connect structural arrangements with functional states

These imaging approaches complement biochemical and spectroscopic methods, providing spatial and temporal information critical for understanding the complete CCS1 catalytic cycle .

What experimental design would best address the stability and reliability of CCA/PLS analyses in CCS1 research?

For researchers considering Canonical Correlation Analysis (CCA) or Partial Least Squares (PLS) approaches in CCS1 studies, careful experimental design is crucial:

  • Sample Size Determination:

    • Critical Consideration: CCA/PLS analyses require large sample sizes to achieve stability

    • Recommendation: For typical CCS1 studies with 100 features per set, collect at least 1,000 observations to obtain reasonably stable results

    • Optimal Case: 20,000 or more observations provide highly stable and reliable mappings

  • Cross-Validation Strategy:

    • Methodology: Implement k-fold cross-validation (k≥5) to assess model stability

    • Assessment Metrics: Calculate both in-sample and out-of-sample association strengths

    • Interpretation Guide: Be aware that in-sample estimates typically overestimate true values while cross-validated estimates underestimate them by a similar degree

  • Weight Stability Analysis:

    • Required Testing: Assess weight stability across independent collections of samples

    • Warning Sign: Weight stability close to 0 for CCA indicates insufficient sample size

    • Verification Method: Compare weight vectors from independent subsamples using correlation analysis

  • Feature Selection Considerations:

    • Best Practice: Reduce dimensionality before applying CCA/PLS

    • Method Options: Employ principal component analysis or domain knowledge-based feature selection

    • Guideline: Maintain at least a 10:1 ratio of observations to features

Research has shown that at small sample sizes (n<1,000), CCA weight vectors exhibit high error and poor stability. This dramatically improves as sample size increases, with stability approaching optimal levels around n=20,000 for datasets with 100 features .

By implementing these experimental design considerations, researchers can avoid common pitfalls in multivariate analyses and produce reliable results when studying the complex relationships in CCS1 biology and function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.