Recombinant Cytochrome c biogenesis protein ccsB (ccsB)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cytochrome c Biogenesis

CcsB operates in a bifunctional system with CcsA, enabling two key processes:

  1. Heme Transport:

    • Transfers reduced heme (Fe²⁺) from the cytoplasm to the periplasm via the TM heme channel .

    • Mutations in TM-His residues disrupt transport, but function is restored by exogenous imidazole, mimicking heme channel activity .

  2. Cytochrome c Synthetase Activity:

    • Positions heme in the WWD domain for covalent attachment to the apocytochrome c CXXCH motif .

    • Requires reduced heme (Fe²⁺) and cysteine thioreduction by periplasmic disulfide bonds (e.g., DsbD) .

In Vitro Reconstitution Studies

  • CcsBA Activity: Purified recombinant CcsBA (including CcsB) reconstitutes cytochrome c synthesis without auxiliary factors .

  • Substrate Specificity:

    • Bacterial CcsBA: Requires CXXCH motif and histidine but not α-helix 1 .

    • Human HCCS: Requires α-helix 1 for recognition, unlike CcsBA .

StudyOrganismMethodKey Finding
Cryo-EM Structures Helicobacter3D cryo-EMHeme transport via conformational shifts
In Vitro Synthesis E. coliPurified CcsBAPeptide analogs inhibit heme attachment
Imidazole Complementation H. hepaticusMutagenesisTM-His mutants rescued by imidazole

Mechanistic Model

  1. Heme Transport:

    • Reduced heme binds TM-His1/TM-His2, forming a channel for transmembrane transfer .

  2. Heme Attachment:

    • External ligands (P-His1/P-His2) replace TM-His residues, positioning heme for CXXCH binding .

  3. Release:

    • WWD domain facilitates heme-vinyl access to cysteines, enabling covalent linkages .

Applications and Significance

  • Biochemical Tools: Recombinant CcsB aids in studying heme trafficking and cytochrome c folding .

  • Therapeutic Targets: Insights into CcsB mechanisms may inform strategies for manipulating bacterial electron transport systems .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
ccsB; ccs1; PCC_0191; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-435
Protein Length
full length protein
Species
Paulinella chromatophora
Target Names
ccsB
Target Protein Sequence
MKHVLKWISDLRVAIFLLLIIALSSSLGTALPQKESAESYYEAYNSSPWLKVFSGESIIQ LQLDHVYSSDWFLSLLLWLGIALVFCSWRRQLPALQFTLRWIDYCNPRQLSKLALAETII STDASASIKRLEQLLKNQGWQVQAKSGRLAARRGIAGRVGPLMVHTGLVILMLGAVWGVL GGHRLERFLAPGREMELLNSHGKSQLNIALESFQIERDPVGRPEQYRSQLRLRELGNSRE NNSGSIDKSLNREISVNHPLRYGGMTVYQADWALAAITVQLGRSPLLQLPLEQFPQLGEQ VWGVVLPTQQDGSNPVLLALSSEKGPIEVFASDGSLITTLRPGGVAATINDVKVRVESIL PASGLLLKRDPGVPLVYIGFAVALMGGGLSLISTRQIWAIAELEQQRFHVGGLCNREFTN FAQELPQFISEIQQI
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Protein Families
Ccs1/CcsB family
Subcellular Location
Plastid, organellar chromatophore thylakoid membrane; Multi-pass membrane protein.

Q&A

What is CcsBA and how does it function in bacterial cytochrome c biogenesis?

CcsBA is a bifunctional integral membrane protein that functions as both a heme transporter and cytochrome c synthase in bacterial System II. CcsBA facilitates the export of heme from the cytoplasm to the periplasm and catalyzes its covalent attachment to the CXXCH motif of apocytochrome c .

Recent cryo-EM studies reveal that CcsBA exists in two conformational states:

  • Closed state: Heme located solely at a transmembrane (TM) site, with periplasmic domain oriented to deny heme access to cytochrome acceptors

  • Open state: Contains two heme moieties (one in TM-heme site, another in periplasmic P-heme site), with a large conformational shift exposing heme for reaction with apocytochrome c

The protein contains conserved histidine residues in the transmembrane domains essential for heme transport, plus external histidines serving as axial ligands that protect heme from oxidation .

How do bacterial and mitochondrial cytochrome c biogenesis systems differ?

FeatureBacterial CcsBAHuman/Mitochondrial HCCS
Recognition requirementsBoth thiols and histidine in CXXCH motif required; alpha helix 1 not necessaryMinimal 16-mer peptide with CXXCH and alpha helix 1 required; neither thiol critical for recognition
Structural organization10 transmembrane domains with external WWD domainSmaller membrane-associated protein
Heme binding sitesTM-heme site and P-heme site (periplasmic)Single active site requiring His154
Release mechanismPeptide analogs with attached heme appear to be released from active siteHeme-attached peptide analogs not released; folding required for release

These fundamental differences between human and bacterial systems could potentially lead to new antibiotics targeting bacterial cytochrome c synthase while sparing patients .

What expression systems and purification strategies are most effective for recombinant CcsBA?

CcsBA can be effectively produced using recombinant expression in E. coli. The following approach has proven successful:

  • Express CcsBA as an N-terminal fusion to GST (glutathione S-transferase)

  • Solubilize the membrane protein in n-dodecyl β-d-maltoside (DDM)

  • Purify using affinity chromatography to >95% purity

For improved yield, researchers have developed a C-terminal hexahistidine-tagged CcsBA. Interestingly, yields were higher when the GST ORF (with stop codon) and a new ribosome binding site upstream were included in the construct .

Purified CcsBA preparations appear red due to associated heme, and typically contain:

  • Full-length protein (133 kDa)

  • Two major polypeptides resulting from a proteolytic event in the periplasmic domain:

    • GST-tagged CcsB* (≈70 kDa)

    • CcsA* (≈55 kDa)

This natural proteolytic susceptibility can serve as a diagnostic tool for studying mutant CcsBA proteins .

How can researchers design valid experimental controls when studying recombinant CcsBA?

When designing single-case experimental designs (SCEDs) for studying CcsBA, several principles should be applied:

  • Establish baseline conditions with no intervention as the initial condition

  • Randomize the order of assignment of interventions to reduce threats to internal validity

  • When possible, blind the intervention and data collection process

For specific CcsBA research, essential controls include:

  • CcsBA variant with mutations in transmembrane histidines (TM-His site)

  • CcsBA variant with mutations in periplasmic histidines (P-His site)

  • Test for rescue of function in histidine mutants using exogenous imidazole

  • Include time-course sampling to establish rate of cytochrome c formation

  • Parallel reactions with human HCCS for comparative analysis

These controls help distinguish genuine effects from competing explanations, addressing threats to internal validity outlined in classic experimental design literature (history, maturation, testing, etc.) .

What methods exist for in vitro reconstitution of cytochrome c biogenesis?

In vitro reconstitution of cytochrome c biogenesis represents a significant methodological advance, as studying cytochrome c synthases in living cells is challenging . The first successful in vitro reconstitution was recently reported using purified components .

Key components for in vitro CcsBA assay:

  • Purified CcsBA protein (wild-type or variant)

  • Apocytochrome c substrate (e.g., equine apocytochrome c chemically stripped of heme)

  • DTT (dithiothreitol) for maintaining reducing environment

  • Anaerobic conditions

Analysis methods:

  • UV-visible spectroscopy (formation of peak at 550 nm diagnostic of c-type cytochromes)

  • SDS-PAGE followed by heme staining

  • HPLC size exclusion chromatography to assess release and proper folding

For System I reconstitution in E. coli, researchers have developed methods using the CcmABCDEFGH bacterial cytochrome c biogenesis pathway, followed by analysis of cytochrome c species by cell lysis and heme stain .

How can peptide analogs be used to study the mechanism of cytochrome c biogenesis?

Peptide analogs containing the CXXCH motif provide valuable insights into substrate recognition and mechanism of action:

PeptideSequence FeaturesRecognized by HCCSRecognized by CcsBA
11-merCXXCH onlyNoYes
16-merCXXCH + alpha helix 1YesYes
20-merCXXCH + extended alpha helix 1YesYes
9-merCXXCH variantNoYes
56-merCXXCH + alpha helix 1 and 2YesYes

These peptide studies reveal that:

  • The minimal recognition unit for HCCS is a 16-mer containing CXXCH plus alpha helix 1

  • CcsBA can recognize shorter peptides with just the CXXCH motif

  • For HCCS, neither thiol in CXXCH is critical for recognition

  • For CcsBA, both thiols and histidine in CXXCH are required

Importantly, peptide analogs can function as inhibitors of cytochrome c biogenesis. When HCCS was incubated with 16-mer or 20-mer peptides before adding apocytochrome c, heme was attached to the peptides but not to apocytochrome c, effectively inhibiting the process .

What is currently known about the mechanism of heme transport through CcsBA?

The CcsBA mechanism involves a complex series of steps integrating both heme transport and attachment functions:

  • Heme binding at the transmembrane (TM) site, involving two conserved histidines in the membrane bilayer

  • Transport of heme from the TM site to the periplasmic (P) site

  • Large conformational change upon heme reaching the P-site, exposing it for reaction

  • Recognition of apocytochrome c CXXCH motif

  • Covalent attachment of heme to the CXXCH cysteines

  • Release of mature cytochrome c

Evidence for this mechanism includes:

  • Mutations in TM histidines block heme transport, but function can be rescued by exogenous imidazole

  • This rescue is analogous to correction of heme binding by myoglobin when its proximal histidine is mutated

  • Cryo-EM structures show distinct conformations with different heme positions

  • The periplasmic WWD domain likely interfaces with the edge of heme facing the CXXCH substrate

How do the histidine residues in CcsBA contribute to its function?

CcsBA contains multiple conserved histidines with specialized roles:

  • Transmembrane histidines:

    • Form a heme binding site within the membrane bilayer

    • Required for heme to travel to the external domain

    • When mutated, function can be rescued by exogenous imidazole

  • Periplasmic histidines (P-His):

    • Serve as axial ligands for heme in the "external heme binding domain"

    • Protect the heme iron from oxidation

    • Form part of the synthetase active site

    • Mutations in P-His residues abolish cytochrome c formation

  • WWD domain histidine:

    • Part of the highly conserved WWD domain

    • Likely interfaces with the edge of heme facing the CXXCH substrate

    • May facilitate release of heme-attached products

These histidine residues and their specific functions represent potential targets for developing selective inhibitors of bacterial cytochrome c biogenesis.

What are common challenges in CcsBA preparation and how can they be addressed?

Researchers working with CcsBA face several technical challenges:

  • Proteolytic susceptibility:

    • CcsBA shows natural proteolytic cleavage in the periplasmic domain

    • Solution: This can be used as a diagnostic tool; observe GST-CcsB* (≈70 kDa) and CcsA* (≈55 kDa) fragments

  • Maintaining reducing conditions:

    • Both heme and CXXCH thiols must remain reduced for attachment

    • Solution: Include DTT in all preparations and perform reactions anaerobically

  • Spectral complexity:

    • CcsBA with heme at both TM and P sites shows overlapping spectral features

    • Solution: Use second-derivative spectra to delineate and quantitate levels of attached heme

  • Expression optimization:

    • Membrane protein expression can be challenging

    • Solution: Test different tagging strategies (N-terminal GST tag, C-terminal His tag) and expression conditions

  • Protein stability:

    • Integral membrane proteins can be unstable when solubilized

    • Solution: Optimize detergent selection (n-dodecyl β-d-maltoside has proven effective)

What potential applications might emerge from understanding cytochrome c biogenesis?

Understanding the mechanisms of cytochrome c biogenesis opens several research possibilities:

  • Targeted antimicrobials:

    • The significant differences between human HCCS and bacterial CcsBA provide targets for selective inhibition

    • Peptide analogs already show inhibitory effects on cytochrome c biogenesis

    • Focus on compounds that specifically interfere with bacterial cytochrome c synthase while sparing human enzymes

  • Engineered cytochromes:

    • Knowledge of attachment mechanisms may enable creation of modified cytochromes with novel properties

    • In vitro reconstitution systems provide platforms for testing engineered variants

  • Structural biology insights:

    • CcsBA represents a model system for studying conformational changes in membrane proteins

    • Further structural studies may reveal dynamic aspects of membrane protein function

  • Evolutionary understanding:

    • Comparing the different systems (I, II, III) for cytochrome c biogenesis provides insights into the evolution of complex biological processes

    • The divergence between bacterial and mitochondrial systems highlights adaptations of electron transport chains

What statistical approaches are recommended for analyzing data from CcsBA experiments?

When analyzing data from single-case experimental designs with CcsBA, researchers should consider:

  • Two general classes of quantitative measures:

    • Overlap-based measures (e.g., percentage nonoverlapping data)

    • Distance-based measures (e.g., Cohen's d)

  • For highest decision accuracy:

    • Use Tau to guide decision-making about presence/absence of treatment effects

    • Use RD (ratio of distances) or g to quantify magnitude of treatment effects

    • Avoid other overlap-based measures (e.g., PND, dual-criterion method) which don't perform as well

  • When designing experiments:

    • Include equal numbers of observations (3-10) in each phase for optimal statistical power

    • Consider reversal designs, multiple baseline designs, or combined approaches depending on research question

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.