Recombinant Cytochrome c oxidase subunit 1 (cbaA)

Shipped with Ice Packs
In Stock

Description

Protein Architecture

cbaA is a 568-amino acid membrane protein with a theoretical molecular weight of ~63.6 kDa . It contains three transmembrane helices and forms the core of the cytochrome ba₃ oxidase complex, which includes subunits II (168 aa) and IIa (34 aa) . Key structural features include:

  • Heme-binding sites: Two heme groups (a and a₃) and a copper center (CuB) critical for oxygen reduction .

  • Copper center: A dinuclear copper site (CuA) in subunit II facilitates electron transfer from cytochrome c .

Catalytic Activity

cbaA is essential for the enzyme’s reaction:
4 ferrocytochrome c+O2+8H+(side 1)4 ferricytochrome c+4H2O(side 2)4 \text{ ferrocytochrome } c + O_2 + 8 H^+ (\text{side 1}) \rightarrow 4 \text{ ferricytochrome } c + 4 H_2O (\text{side 2})
This process generates a proton gradient across the membrane, driving ATP synthesis .

Key Functional Domains

  • Heme a₃-CuB center: Coordinates oxygen binding and reduction .

  • Subunit interactions: Forms heterotrimers with subunits II and IIa for electron transfer and proton pumping .

Expression Systems

cbaA is typically expressed in E. coli with an N-terminal His-tag for affinity chromatography . Recombinant cbaA retains structural integrity and enzymatic activity, as confirmed by X-ray crystallography (PDB: 4FA7, 2.5 Å resolution) .

Table 2: Recombinant Production Parameters

ParameterDetailSource
Host organismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage bufferTris/PBS-based with 6% trehalose

Enzyme Assembly Studies

  • Heme a insertion: The cbaX gene, cotranscribed with cbaA, encodes a chaperone essential for heme a incorporation. Deletion of cbaX reduces heme a content by 90% and enzymatic activity to 7% of wild-type levels .

  • Mutation analysis: The A204F mutant (PDB: 4FA7) shows altered substrate binding kinetics, highlighting residue-specific roles in catalysis .

Pathogenicity and Host Interactions

  • Rhizoctonia solani: A truncated cbaA homolog (RsIA_CtaG/Cox11) localizes to mitochondria and suppresses host immunity. Coexpression with Os_CoxVIIa induces cell death in Nicotiana benthamiana .

Table 3: cbaA vs. Human COX1

FeaturecbaA (Thermus thermophilus)Human COX1 (MT-CO1)
Gene locationBacterial genomeMitochondrial DNA (H-strand)
SubunitsI, II, IIa (3 total)I, II, III (3 core subunits)
Proton pumpingYesYes
Disease associationNoneLHON, mitochondrial disorders

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize development based on your request.
Synonyms
cbaA; Cytochrome c oxidase subunit 1; Cytochrome c ba(3 subunit I; Cytochrome c oxidase polypeptide I; Cytochrome cba3 subunit 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-108
Protein Length
full length protein
Species
Thermus thermophilus
Target Names
cbaA
Target Protein Sequence
IRALPWDNPAFVAPVLGLLGFIPGGAGGIVNASFTLDYVVHNTAWVPGHFHLQVASLVTL TAMGSLYWLLPNLTGKPISDAQRRLGLAVVWLWFLGMMIMAVGLHWAG
Uniprot No.

Target Background

Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Cytochrome c oxidase subunit 1 in cellular metabolism?

Cytochrome c oxidase subunit 1 (cbaA) functions as the catalytic subunit of the cytochrome c oxidase complex, which is the terminal enzyme in the mitochondrial respiratory chain. This enzyme catalyzes the reduction of molecular oxygen to water while transferring electrons from cytochrome c. Specifically, electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B . This electron transfer process is coupled with proton pumping across the membrane, generating an electrochemical gradient that drives ATP synthesis. In thermophilic bacteria like Thermus thermophilus, the cbaA gene encodes the main subunit (subunit I) of the cytochrome ba3 oxidase complex, which has evolved to function effectively at high temperatures .

How does the structure of cbaA differ between prokaryotes and eukaryotes?

In prokaryotes such as Thermus thermophilus, cbaA (Cytochrome c ba(3) subunit I) is encoded by the cbaA gene and functions as part of the ba3-type cytochrome c oxidase. The protein consists of 108 amino acids and includes transmembrane domains that anchor it in the cell membrane . In eukaryotes, particularly humans, the homologous protein is encoded by the mitochondrial MT-CO1 gene, resulting in a larger 57 kDa protein composed of 513 amino acids . The eukaryotic version is located in the mitochondrial inner membrane and is encoded by mitochondrial DNA rather than nuclear DNA. While both proteins serve as the catalytic core of their respective complexes, the eukaryotic version has evolved additional features for integration into the more complex mitochondrial environment and interacts with many more assembly factors .

What are the optimal conditions for expressing recombinant cbaA protein in bacterial systems?

The expression of recombinant cbaA protein requires careful optimization due to its membrane-associated nature. For successful expression:

  • Expression system selection: E. coli BL21(DE3) strains containing chaperone plasmids (e.g., pG-KJE8) provide better folding assistance for membrane proteins.

  • Growth conditions:

    • Initial culture at 37°C until OD600 reaches 0.6-0.8

    • Temperature reduction to 18-20°C before induction

    • IPTG concentration: 0.1-0.5 mM (lower concentrations often yield better folding)

    • Extended expression period: 16-20 hours at the reduced temperature

  • Membrane fraction isolation:

    • Cell disruption by sonication in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Membrane solubilization using 1-2% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin

    • Purification via His-tag affinity chromatography using imidazole gradient elution

  • Storage conditions:

    • Tris-based buffer with 50% glycerol at -20°C for short-term storage

    • For extended storage, aliquot and store at -80°C to prevent repeated freeze-thaw cycles

This approach yields properly folded protein with maintained structural integrity and functional activity.

How can researchers effectively detect and quantify cbaA using ELISA techniques?

For reliable quantification of cbaA/MT-CO1 using ELISA techniques:

  • Sample preparation:

    • For tissue samples: Homogenize in PBS with protease inhibitors, centrifuge at 10,000×g for 10 minutes, and collect supernatant

    • For cell cultures: Harvest cells, lyse with appropriate buffer, centrifuge to remove debris

    • For plasma/serum: Dilute 1:2 to 1:5 with sample diluent

  • Assay procedure:

    • Use sandwich ELISA format with anti-cbaA/MT-CO1 capture antibodies

    • Standard curve range: 78-5000 pg/ml with 35 pg/mL sensitivity

    • Incubation time: 2 hours at 37°C for sample binding

    • Detection using HRP-conjugated secondary antibody

    • Color development with TMB substrate for 15-30 minutes

    • Measurement at 450 nm with correction at 540 nm

  • Data interpretation:

    • Calculate concentrations using four-parameter logistic curve fitting

    • Expected intra-assay CV: 5.4%

    • Expected inter-assay CV: 9.6%

For optimal reproducibility, all reagents should be equilibrated to room temperature before use, and samples should be analyzed in duplicate or triplicate.

How do mutations in cbaA/MT-CO1 contribute to mitochondrial disease pathogenesis, and what experimental models best demonstrate these effects?

Mutations in cbaA/MT-CO1 contribute to disease pathogenesis through several mechanisms:

Optimal experimental models:

  • Cybrid cell models: Transfer mitochondria from patient cells to ρ0 cells (lacking mtDNA) to isolate the effects of mtDNA mutations in controlled nuclear backgrounds.

  • Mouse models: Introducing specific MT-CO1 mutations using mitochondrial targeted nucleases or selection-based approaches.

  • Patient-derived fibroblasts: Primary cultures that maintain the original mutation for direct study of biochemical defects.

  • Yeast models: S. cerevisiae with equivalent mutations in the COX1 gene to study conserved functional impacts and test potential therapeutic compounds .

What recent advances have improved our understanding of cbaA/MT-CO1's role in proton pumping during oxidative phosphorylation?

Recent high-resolution structural studies have significantly advanced our understanding of cbaA/MT-CO1's proton pumping mechanisms:

  • Improved X-ray crystallography resolution (1.5/1.6 Å): The 2016 breakthrough in resolution of oxidized/reduced bovine cytochrome c oxidase allowed visualization of:

    • Precise positioning of water molecules in proton transfer pathways

    • Conformational changes between oxidized and reduced states

    • Detailed structures of all six catalytic intermediates

  • Identification of crucial proton pathways:

    • D-pathway: Primary pathway for both chemical protons and pumped protons

    • K-pathway: Delivers protons in the reductive phase (O→E and E→R transitions)

    • H-pathway: Alternative proton pumping site across the protein from N-side to P-side

  • Elucidation of redox-coupled structural changes:

    • Movement of specific amino acid side chains during electron transfer

    • Conformational changes in heme groups affecting proton affinity

    • Identification of proton-loading sites (PLS) that transiently hold protons before release

  • Time-resolved studies using XFEL:

    • Captured structural changes during CO photolysis in fully reduced CcO

    • Provided insights into oxygen binding and electron transfer kinetics

    • Demonstrated coupling between electron and proton movement

The detailed redox-coupled dynamics revealed that electrostatic interactions between pumped protons and the net positive charges created during O₂ reduction drive the proton pump mechanism, with specific amino acid residues serving as "gates" to prevent proton backflow.

What are the common challenges in purifying functional recombinant cbaA, and how can they be addressed?

Purification of functional recombinant cbaA presents several challenges due to its membrane protein nature and cofactor requirements:

ChallengeCauseSolution
Low expression levelsToxicity to host cells, protein misfoldingUse C41/C43 E. coli strains specifically designed for membrane proteins; lower induction temperature to 16-18°C; use ArcticExpress cells
Protein aggregationImproper detergent selection or concentrationTest multiple detergents (DDM, LMNG, digitonin); use purification buffers with 10-20% glycerol as stabilizer
Loss of heme cofactorsHarsh purification conditionsInclude 5-10 μM hemin in growth media; avoid oxidizing conditions during purification
Poor solubilizationInsufficient detergent extractionOptimize detergent:protein ratio; extend solubilization time to 3-4 hours; try different detergent combinations
Inactive proteinImproper folding or missing cofactorsCo-express with assembly factors; include copper and iron supplements in growth media
Proteolytic degradationVulnerable exposed loopsAdd protease inhibitor cocktail throughout purification; keep samples at 4°C; use PMSF (1 mM)

For functional assessment after purification, the cytochrome c oxidase activity should be verified using a polarographic oxygen electrode or spectrophotometric assay measuring cytochrome c oxidation at 550 nm . Properly purified cbaA should maintain its characteristic absorption spectrum with peaks at approximately 420 nm (Soret band) and 600 nm (α-band).

How can researchers accurately assess the enzymatic activity of recombinant cbaA in different experimental systems?

To accurately assess cbaA enzymatic activity:

  • Spectrophotometric assays:

    • Measure the oxidation rate of reduced cytochrome c at 550 nm

    • Reaction conditions: 50 μM reduced cytochrome c in 20 mM KH₂PO₄ (pH 7.4)

    • Calculate activity as μmol cytochrome c oxidized/min/mg protein

    • Confirm specificity using 0.3 mM KCN as inhibitor control

  • Oxygen consumption measurements:

    • Clark-type oxygen electrode to measure O₂ consumption rate

    • Standardize with sodium dithionite for complete O₂ depletion

    • Compare activity in the presence and absence of specific inhibitors

  • Proton pumping assays:

    • Reconstitute purified protein into liposomes

    • Monitor pH changes with pH-sensitive dyes or microelectrodes

    • Assess H⁺/e⁻ stoichiometry by comparing proton translocation to electrons transferred

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy to measure rapid kinetics

    • Flash photolysis for time-resolved measurements

    • Monitor absorbance changes at wavelengths specific for different intermediates

  • Membrane potential measurements:

    • Use voltage-sensitive dyes (e.g., DiSC3(5), JC-1)

    • Quantify generated membrane potential in reconstituted systems

    • Compare wild-type to mutant forms to assess functional impacts

For accurate comparisons between experiments, standardize assays by:

  • Using the same buffer conditions across experiments

  • Ensuring consistent temperature (typically 25°C for mesophilic or 60-65°C for thermophilic enzymes)

  • Measuring activity within the linear range of enzyme concentration

  • Including standard controls with known activity in each experimental set

How do the different catalytic intermediates in the cbaA reaction cycle influence proton pumping efficiency?

The catalytic cycle of cbaA involves distinct intermediates that differently affect proton pumping:

IntermediateFe₃₃/Cu<sub>B</sub> StateDescriptionProton Pumping Contribution
R (Reduced)Fe<sub>a3</sub><sup>2+</sup>, Cu<sub>B</sub><sup>1+</sup>, Tyr244OHStarting fully reduced stateNo pumping in this state
A (Adduct)Fe<sub>a3</sub><sup>2+</sup>-O₂, Cu<sub>B</sub><sup>1+</sup>, Tyr244OHO₂ bound to reduced hemeInitial step, no pumping yet
P<sub>m</sub> (Peroxy)Fe<sub>a3</sub><sup>4+=O</sup><sup>2-</sup>, Cu<sub>B</sub><sup>2+</sup>-OH⁻, Tyr244O-After O-O bond cleavageFirst proton pumping event occurs
F (Ferryl)Fe<sub>a3</sub><sup>4+=O</sup><sup>2-</sup>, Cu<sub>B</sub><sup>2+</sup>-OH⁻, Tyr244OHAfter tyrosyl radical reductionSecond proton pumping event
O (Oxidized)Fe<sub>a3</sub><sup>3+</sup>-OH⁻, Cu<sub>B</sub><sup>2+</sup>-OH⁻, Tyr244OHFully oxidized intermediateThird proton pumping event
E (Electronic)Fe<sub>a3</sub><sup>3+</sup>-OH⁻, Cu<sub>B</sub><sup>1+</sup>-H₂O, Tyr244OHSingle electron reduced stateFourth proton pumping event

The P<sub>m</sub>→F transition is particularly crucial for proton pumping efficiency. During this step, the Tyr244 radical is reduced and protonated, driving the first proton pumping event. The electrostatic repulsion between the chemical proton (used for water formation) and the pumping proton provides the driving force for translocation .

Recent experimental evidence using time-resolved spectroscopy has identified a peroxide-bound form between A and P<sub>m</sub> and F<sub>r</sub> (a one-electron reduced F-form), providing deeper insights into the coupling mechanism. The net positive charges created during O₂ reduction trigger electrostatic repulsion that drives proton translocation across the membrane against the electrochemical gradient .

Studies in thermophilic bacteria have shown that the ba3-type oxidases maintain efficient proton pumping even at high temperatures, with structural adaptations that stabilize the intermediates while preserving the proton transfer pathways.

What methodological approaches can effectively differentiate between mutations affecting catalytic function versus those impairing assembly of cbaA into the cytochrome c oxidase complex?

Differentiating between mutations affecting catalytic function versus assembly requires complementary approaches:

  • Steady-state enzyme kinetics:

    • Measure K<sub>m</sub> and V<sub>max</sub> parameters for cytochrome c oxidation

    • Compare turnover numbers (k<sub>cat</sub>) between wild-type and mutant forms

    • Analysis of inhibitor sensitivity profiles (e.g., cyanide, azide)

    • Interpretation: Altered kinetic parameters with normal expression levels suggest catalytic defects

  • Blue Native PAGE analysis:

    • Evaluate assembled complex IV levels and assembly intermediates

    • Monitor subunit incorporation using antibodies against different subunits

    • Track assembly kinetics with pulse-chase experiments

    • Interpretation: Accumulation of subcomplexes indicates assembly defects

  • Mitochondrial translation analysis:

    • Measure synthesis rates of mtDNA-encoded subunits with 35S-methionine labeling

    • Determine stability of newly synthesized subunits

    • Interpretation: Normal synthesis but rapid degradation suggests assembly failure

  • Import assays for nuclear-encoded partners:

    • Test import efficiency of partner subunits into mitochondria

    • Analyze partner protein stability in the presence of mutant cbaA

    • Interpretation: Defects in partner stability indicate assembly problems

  • Interaction studies with assembly factors:

    • Co-immunoprecipitation with known assembly factors (e.g., SURF1, COA3, COX14)

    • Affinity purification followed by mass spectrometry

    • Yeast two-hybrid or mammalian two-hybrid assays

    • Interpretation: Altered interactions with assembly factors suggest assembly defects

  • Spectroscopic analysis of heme incorporation:

    • Absorption spectra to detect characteristic peaks for heme a and heme a3

    • Resonance Raman spectroscopy for heme environment assessment

    • EPR spectroscopy for analyzing metal centers

    • Interpretation: Altered spectra despite protein expression indicate cofactor insertion problems

These approaches should be used in combination, as some mutations can affect both catalytic function and assembly to varying degrees.

What is the evidence linking specific cbaA/MT-CO1 mutations to mitochondrial diseases, and how do these mutations affect enzyme function?

Several MT-CO1 mutations have been linked to mitochondrial diseases with substantial evidence regarding their functional effects:

DiseaseMutationFunctional EffectClinical Manifestations
Leber Hereditary Optic Neuropathy (LHON)m.3460G>A, m.3635G>A, m.3700G>ADisrupted electron transfer pathway; decreased catalytic efficiencyAcute/subacute central vision loss; cardiac conduction defects; neurological manifestations
Mitochondrial Complex IV Deficiencym.6930G>A, m.7402del, m.7587T>CImpaired complex assembly; reduced enzyme activity by >70%Hypertrophic cardiomyopathy; hepatomegaly; hypotonia; developmental delay; Leigh syndrome
Acquired Idiopathic Sideroblastic AnemiaMultiple MT-CO1 mutationsImpaired reduction of ferric to ferrous iron; disrupted heme biosynthesisRing sideroblasts in bone marrow; anemia; iron overload
Recurrent Myoglobinuriam.6930G>A, m.7007G>ACompromised energy production in skeletal muscle; increased ROSRecurrent rhabdomyolysis; muscle pain and weakness; myoglobinuria
Sensorineural Deafnessm.7444G>A, m.7445A>GDefective complex IV in cochlear cellsProgressive high-frequency hearing loss; maternal inheritance pattern
Colorectal CancerSomatic mutations (various)Metabolic reprogramming; altered apoptotic responseContributes to Warburg effect; potential biomarker

Functional evidence has been established through:

  • Transmitochondrial cybrid studies: Demonstrating the pathogenicity of mutations by transferring patient mitochondria to ρ0 cells, showing 30-80% decrease in COX activity depending on the mutation.

  • Biochemical analyses: Revealing reduced cytochrome c binding affinity, altered proton pumping efficiency, and increased ROS production.

  • Biophysical characterization: Showing perturbations in the redox potential of the metal centers and altered electron transfer kinetics .

The mechanistic understanding helps explain the tissue-specific manifestations, as tissues with high energy demands (retina, cardiac muscle, neurons) are particularly sensitive to even minor reductions in cytochrome c oxidase activity.

How do environmental factors and genetic background influence the phenotypic expression of cbaA/MT-CO1 mutations?

The phenotypic expression of cbaA/MT-CO1 mutations is significantly modulated by both environmental factors and genetic background:

  • Environmental modifiers:

    • Oxidative stress exposure: Environmental toxins, cigarette smoke, and radiation increase ROS production, exacerbating the impact of mutations that already compromise electron transport.

    • Hypoxic conditions: Cells with MT-CO1 mutations show dramatically reduced survival under hypoxia compared to wild-type cells.

    • Caloric intake: High-calorie diets increase the penetrance and severity of phenotypes in animal models, while caloric restriction often ameliorates symptoms.

    • Temperature: In thermophilic bacteria, temperature fluctuations significantly affect the function of cbaA mutations, with some mutations showing temperature-sensitive phenotypes.

  • Genetic background effects:

    • Mitochondrial DNA haplogroups: The same MT-CO1 mutation can cause severe LHON in haplogroup J but remain asymptomatic in haplogroup H.

    • Nuclear modifier genes: Variations in assembly factors like SURF1, COA3, and COX14 can either exacerbate or suppress the effects of primary MT-CO1 mutations.

    • mtDNA heteroplasmy levels: The percentage of mutant mtDNA molecules varies between tissues and impacts disease severity, with threshold effects typically requiring >60-80% mutant load for biochemical defects.

    • Compensatory mechanisms: Upregulation of alternative oxidases or increased mitochondrial biogenesis can partially compensate for MT-CO1 defects in some genetic backgrounds.

  • Experimental evidence from model systems:

    • Mouse models with identical MT-CO1 mutations show dramatically different phenotypes across different nuclear backgrounds.

    • Yeast studies demonstrate that the same COX1 mutation causes respiratory deficiency in some strains but is well-tolerated in others.

    • Cell culture experiments reveal that expression of certain nuclear genes can rescue MT-CO1 mutation phenotypes, suggesting potential therapeutic approaches .

These findings highlight the importance of considering the full genetic and environmental context when assessing the potential pathogenicity of cbaA/MT-CO1 variants and explain the variable penetrance observed in mitochondrial diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.