Recombinant Cytochrome c oxidase subunit 2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Pneumocystis carinii
Target Protein Sequence
MNNIIHNDAPTPWGIYFQDGASPVYDGIVELHDQVLFYLLIVLVGVSWILFSTILRFRGS GIVHKYHNHSTTIEFVWTVSPALLLIAIAFPSFKLLYLMDEVIDPSITIKAIGHQWYWSY EYSDYTDKEGQSIEFDSYMLPTEDLEEGQLRQLEVDNRVLVPVNTPLRFIITATDVLHDF AVPSLGIKVDASPGRLNQVSTYVQREGVYYGQCSELCGVLHSSMPIVIEAVSLEKFLSWL DNQ
Uniprot No.

Target Background

Function
Recombinant Cytochrome c oxidase subunit 2 is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme A3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase subunit 2 and what is its functional role?

Cytochrome c Oxidase subunit 2 (Cox2) is a critical component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. Cox2 contains two transmembrane domains (TMS1 and TMS2) with an N-out-C-out topology in the inner mitochondrial membrane. It plays an essential role in the enzyme that catalyzes the reduction of oxygen to water . In the respiratory chain mechanism, electrons originating from reduced cytochrome c in the intermembrane space are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site, where molecular oxygen is reduced to water molecules using electrons from cytochrome c and protons from the mitochondrial matrix .

What is allotopic expression of Cox2 and why is it significant for research?

Allotopic expression refers to the artificial relocation of an organellar gene to the nucleus. In the specific case of Cox2, researchers have successfully relocated the mitochondrial cox2 gene to the nucleus in yeast (Saccharomyces cerevisiae), enabling the production of a functional protein that can restore respiratory growth to a Δcox2 null mutant . This approach is significant for several reasons:

  • It provides a model system for studying mitochondrial protein import

  • It offers potential strategies for addressing mitochondrial genetic disorders

  • It allows for genetic manipulation techniques not possible with mitochondrial genes

  • It enables the study of evolutionary processes related to gene transfer between organelles and nucleus

For successful allotopic expression, the cytosol-synthesized Cox2 precursor requires specific modifications, including a mitochondrial targeting sequence, the natural 15-residue leader peptide, and critical amino acid substitutions that decrease the hydrophobicity of TMS1 to facilitate import .

What are the structural characteristics of Cox2 that impact its recombinant expression?

Cox2 possesses several structural features that pose challenges for recombinant expression:

  • Two transmembrane domains (TMS1 and TMS2) with high hydrophobicity

  • An N-terminus and C-terminus that both face the intermembrane space (N-out-C-out topology)

  • Contains the dinuclear copper A (CuA) center essential for electron transfer

  • Requires proper folding and membrane insertion for functionality

The hydrophobic nature of TMS1 presents the most significant barrier to recombinant expression, as it can impede efficient import into mitochondria when the protein is produced in the cytosol. This is why amino acid substitutions that reduce hydrophobicity (such as W56R) are crucial for successful allotopic expression .

What specific mutations facilitate the import of allotopically expressed Cox2?

Several key mutations have been identified that enhance the import of cytosolically synthesized Cox2:

MutationEffect on TMS1Functional Impact
W56RDecreases hydrophobicityPromotes full translocation via TIM23
W56KDecreases hydrophobicityPromotes full translocation via TIM23
W56QDecreases hydrophobicityPromotes full translocation via TIM23
V49Q/L51GDecreases hydrophobicityPromotes full translocation via TIM23

These mutations specifically target TMS1 and are essential because they diminish its mean hydrophobicity, which promotes complete translocation into the mitochondrial matrix by the TIM23 translocase. Without these modifications, the highly hydrophobic TMS1 would impede efficient import into mitochondria .

What is the recommended expression system for producing recombinant Cox2?

Based on the research data, successful recombinant expression of Cox2 depends on:

  • Expression Host: Yeast (Saccharomyces cerevisiae) has been demonstrated as an effective host system for allotopic Cox2 expression

  • Vector Selection: Both centromeric (low-copy) and multicopy plasmids have been used, though excessive expression from multicopy vectors can cause protein aggregation at the mitochondrial surface

  • Promoter Choice: Strong constitutive promoters are typically used to ensure sufficient expression

  • Targeting Sequence: A mitochondrial targeting sequence (MTS) followed by the natural 15-residue leader peptide of yeast Cox2

  • Critical Mutations: Incorporation of W56R or other hydrophobicity-reducing mutations in TMS1

The research indicates that balanced expression levels are crucial, as both insufficient and excessive Cox2 production can be problematic. Centromeric plasmid-based expression (cenCOX2W56R) appears to provide more consistent results than multicopy plasmid systems (eCOX2W56R) .

What factors enhance the allotopic production and assembly of Cox2?

A high-copy suppressor screen identified three genes whose overexpression significantly enhances the allotopic production and assembly of Cox2 W56R:

GeneProductFunctionFold OverexpressionEffect on Cox2 W56R
TYE7Transcription factorTranscriptional regulation14-foldIncreases mature Cox2 W56R levels; enhances growth at 37°C
RAS2GTP-binding proteincAMP-PKA signaling pathway5-foldIncreases mature Cox2 W56R levels; enhances growth at 37°C
COX12Cox subunit VIbComponent of cytochrome c oxidase3.5-foldIncreases mature Cox2 W56R levels; no effect at 37°C

Overexpression of these genes facilitates the internalization of Cox2 W56R into mitochondria, increases the levels of mature Cox2 W56R, and improves respiratory growth on non-fermentable carbon sources. Both TYE7 and RAS2 also enhance growth at elevated temperatures (37°C) .

How does the biogenesis pathway of allotopically expressed Cox2 differ from the native pathway?

The biogenesis pathway of allotopically expressed Cox2 differs significantly from the native pathway:

StageNative Cox2 (Mitochondrially Synthesized)Allotopic Cox2 (Nuclear Synthesized)
Initial synthesis locationMitochondrial matrixCytosol
Import mechanismNone (synthesized in situ)TOM complex → TIM23 translocase
TMS1 insertionDirect insertion by Oxa1Matrix import, then Oxa1-mediated insertion
TMS2 translocationRequires Cox18Does not require Cox18
Processing stepsImp1 removes leader peptideMTS removal by mitochondrial processing protease followed by leader peptide removal by Imp1

For allotopically produced Cox2, the precursor enters mitochondria through the TOM complex and is subsequently sorted by the TIM23 translocase. The MTS is removed by the mitochondrial processing protease when it reaches the matrix. The Oxa1 insertase then recognizes the leader peptide and inserts TMS1 into the inner mitochondrial membrane. When the N-terminus is exposed to the intermembrane space, Cox20 stabilizes TMS1, and the Imp1 protease removes the leader peptide. Meanwhile, TMS2 is retained by the TIM23 complex and released laterally into the inner membrane, establishing the proper N-out-C-out topology .

What are the limitations of allotopic Cox2 expression and how can they be overcome?

Allotopically produced Cox2 W56R exhibits several limitations compared to wild-type Cox2:

  • Lower steady-state levels of cytochrome c oxidase

  • Diminished rates of oxygen uptake

  • Potential aggregation at the mitochondrial surface when overexpressed

These limitations are not due to the W56R mutation itself (as mitochondrially synthesized Cox2 W56R functions normally) but rather result from inefficiencies in the import and assembly process. Several strategies can overcome these limitations:

  • Overexpression of specific factors like TYE7, RAS2, and COX12

  • Optimization of the TIM23 translocase function through regulators like Mgr2

  • Careful balancing of expression levels using appropriate vectors and promoters

  • Fine-tuning of growth conditions (temperature, carbon source)

  • Engineering of additional mutations that further improve import efficiency

Research has shown that the independent overexpression of TYE7, RAS2, and COX12 genes increases the levels of mature Cox2 W56R and enhances respiratory growth .

How does the RAS2 signaling pathway influence mitochondrial biogenesis and Cox2 assembly?

The RAS2 gene encodes a GTP-binding protein involved in the cAMP-PKA signaling pathway, which has broad effects on cellular metabolism and mitochondrial function. While RAS2 overexpression enhances allotopic Cox2 W56R production and respiratory growth, the exact mechanism remains unclear.

Interestingly, despite expectations, RAS2 overexpression does not increase expression of mitochondrial genes like cox1 and cox3. This suggests that rather than acting at the transcriptional level, RAS2 likely influences post-translational aspects of Cox2 processing or assembly. The cAMP pathway regulated by Ras proteins positively affects mitochondrial biogenesis more broadly, which may create a more favorable environment for the integration of allotopically produced Cox2 .

How does COX12 overexpression specifically benefit allotopic Cox2 expression?

The COX12 gene encodes subunit VIb (Cox12), a loosely bound soluble subunit of cytochrome c oxidase that faces the intermembrane space. Its overexpression facilitates the internalization of allotopic Cox2 W56R into mitochondria through mechanisms that may include:

  • Direct interaction with newly imported Cox2, potentially stabilizing it during assembly

  • Interaction with assembly factors Rcf1 and Rcf2, which regulate respiratory complex biogenesis

  • Creating a scaffold that facilitates proper folding and integration of Cox2

  • Altering the dynamics of cytochrome c oxidase assembly to accommodate allotopically produced subunits

Cox12 is required for the formation of active cytochrome c oxidase, and its absence results in diminished enzyme activity. Thus, increasing Cox12 levels may help overcome rate-limiting steps in the assembly of cytochrome c oxidase containing allotopically produced Cox2 .

What are the recommended methods for evaluating successful expression and assembly of recombinant Cox2?

Based on research protocols, several complementary approaches should be used to assess recombinant Cox2 expression and assembly:

  • Growth Analysis: Measuring growth on non-fermentable carbon sources (like lactate) to assess respiratory function

  • Oxygen Consumption: Quantifying oxygen uptake rates to evaluate cytochrome c oxidase activity

  • Immunoblotting: Detecting both precursor and mature forms of Cox2 to assess import efficiency

  • BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis): Analyzing assembled respiratory complexes

  • Spectroscopic Analysis: Examining characteristic absorbance peaks of cytochrome c oxidase

  • Thermal Stress Testing: Evaluating growth at elevated temperatures (e.g., 37°C) to assess robustness

These methods provide complementary information about different aspects of Cox2 expression, import, processing, and functional assembly .

What are common experimental challenges when working with recombinant Cox2 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Cox2:

ChallengePotential Solutions
Poor import efficiencyIntroduce hydrophobicity-reducing mutations (W56R, W56K, etc.); overexpress import facilitators (TYE7, RAS2, COX12)
Protein aggregationOptimize expression levels; use centromeric rather than multicopy vectors
Incomplete assemblyAdjust growth conditions; ensure sufficient levels of other Cox subunits
Low enzyme activityVerify copper availability; optimize assembly conditions
Variable resultsStandardize growth conditions; use internal controls

Additionally, careful attention to strain background, plasmid stability, and growth phase is essential for reproducible results. For assessing mitochondrial function, it's important to use freshly prepared samples and standardized assay conditions .

What unresolved questions remain regarding the mechanism of allotopic Cox2 expression?

Several key questions remain unanswered regarding the mechanisms underlying successful allotopic Cox2 expression:

  • How exactly do TYE7, RAS2, and COX12 facilitate Cox2 import and assembly at the molecular level?

  • What is the precise role of the TIM23 complex in regulating the import of allotopically expressed Cox2?

  • How does the W56R mutation specifically affect interactions with import machinery?

  • What are the rate-limiting steps in the assembly of cytochrome c oxidase containing allotopically produced Cox2?

  • Can the principles learned from Cox2 allotopic expression be applied to other mitochondrially encoded proteins?

Addressing these questions will require further genetic screens, structural studies, and detailed biochemical analyses of the import and assembly processes .

How might allotopic expression strategies for Cox2 be applied to address mitochondrial diseases?

The successful allotopic expression of Cox2 provides a foundation for potential therapeutic approaches to mitochondrial diseases caused by mutations in mitochondrial DNA. Key considerations for translational applications include:

  • Developing optimized nuclear versions of mitochondrial genes that can be efficiently imported

  • Identifying additional factors that enhance import and assembly of allotopically expressed proteins

  • Creating delivery systems that can target nuclear genes to affected tissues

  • Engineering mitochondrial targeting sequences optimized for different cell types and tissues

  • Developing strategies to regulate expression levels to avoid detrimental effects of over or under-expression

While significant challenges remain for clinical applications, the fundamental insights gained from Cox2 allotopic expression in yeast provide valuable direction for future therapeutic development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.