Recombinant Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Lasius sp.
Target Names
COII
Target Protein Sequence
MNTWLLSLQNSNSPTYDMMIFFHDFTMMILIFITLLILFIMFTMINNNLINRFLLQGHFI ELIWTITPMIILILIAIPSFKILYLTDEMFNNKITIKSVGHQWYWSYEYSDFLNIEFDSF MIPSNQLNPNEFRLLDTDNRCILPFNYPIRILTTSMDVIHSWTVPSLGIKMDSTPGRLNQ SLLYMYRPGLYFGQCSEICGTNHSFMPIVIESTNFSYFKNWLKSFL
Uniprot No.

Target Background

Function
Recombinant Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives both transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC then reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Cytochrome c Oxidase Subunit 2?

Cytochrome c Oxidase Subunit 2 (abbreviated as COII, COX2, COXII, or MT-CO2) is one of three mitochondrially-encoded subunits of respiratory Complex IV. The protein contains two transmembrane α-helices with an N-out-C-out topology and houses the dinuclear copper A center (CuA) . This subunit plays a critical role in electron transfer, receiving electrons from reduced cytochrome c in the intermembrane space (IMS) via its CuA center, then transferring them to heme A of subunit 1 and ultimately to the active site binuclear center (BNC) . The human MT-CO2 gene spans 683 base pairs on mitochondrial DNA and produces a 25.6 kDa protein composed of 227 amino acids .

What expression systems are most effective for producing functional recombinant COX2?

The optimal expression system depends on your research objectives. For structural and functional studies, wheat germ cell-free expression systems have proven effective for producing full-length human COX2 protein suitable for ELISA and Western blot applications . For in vivo studies, yeast systems (particularly Saccharomyces cerevisiae) offer advantages since they enable allotopic expression - the relocation of the mitochondrially-encoded gene to the nucleus.

Successful expression requires several modifications:

  • Addition of a mitochondrial targeting sequence (MTS)

  • Retention of the natural 15-residue leader peptide

  • Introduction of specific amino acid substitutions (e.g., W56R, W56K, W56Q, or V49Q/L51G) that decrease the hydrophobicity of the first transmembrane segment (TMS1) to facilitate import

What are the key challenges in allotopic expression of COX2 and how can they be overcome?

Allotopic expression of COX2 (relocating the gene from mitochondrial to nuclear DNA) faces several key challenges:

  • Import barriers: The high hydrophobicity of transmembrane domains impedes translocation through mitochondrial import channels.

  • Protein stability: Cytosol-synthesized COX2 can aggregate at the mitochondrial surface when expressed at high levels.

  • Assembly complexity: Proper incorporation into the cytochrome c oxidase complex requires multiple assembly factors.

Recent research has identified three genes whose overexpression facilitates the internalization of allotopically expressed COX2:

GeneFold Increase in ExpressionFunctionEffect on COX2
TYE714-foldTranscription factorEnhances COX2 import
RAS25-foldGTP-binding proteinFacilitates COX2 internalization
COX123.5-foldNon-core subunit of cytochrome c oxidaseSpeeds copper delivery and assembly of CuA center

The W56R mutation in TMS1 is particularly effective in decreasing hydrophobicity, promoting full translocation into the mitochondrial matrix via the TIM23 translocator .

What are the most effective assays for measuring the activity of recombinant COX2 in experimental systems?

When designing experiments to measure recombinant COX2 activity, consider both direct enzyme activity assays and assembly assessments:

Direct Activity Measurement:
Cytochrome c oxidase activity can be measured spectrophotometrically by monitoring the oxidation rate of reduced cytochrome c at 550 nm. This assay should be normalized to citrate synthase activity to control for mitochondrial content differences between samples .

Preparation Protocol:

  • Prepare microsomal fractions by homogenizing samples in extraction buffer (10 mM HEPES pH 7.5, 200 mM mannitol, 70 mM sucrose, 1 mM EGTA, and protease inhibitors)

  • Centrifuge homogenates at 600 × g

  • Measure both COX activity and citrate synthase activity in the supernatant

Assembly Assessment:
Beyond enzymatic activity, assess proper assembly of recombinant COX2 into the cytochrome c oxidase complex using:

  • Blue native PAGE to identify intact complex IV

  • Immunoblotting for detection of mature vs. precursor forms of COX2

  • Copper supplementation experiments to evaluate metal center formation

How should researchers design experiments to study the effects of amino acid substitutions on COX2 import into mitochondria?

A comprehensive experimental design for studying amino acid substitutions in COX2 should include:

  • Systematic mutagenesis approach:

    • Target conserved residues in transmembrane segments

    • Focus on hydrophobic-to-hydrophilic substitutions (e.g., W56R, W56K, W56Q)

    • Create double mutations (e.g., V49Q/L51G) to test cumulative effects

  • Vector design considerations:

    • Compare centromeric (low-copy) vs. episomal (multi-copy) expression vectors

    • Include appropriate mitochondrial targeting sequence and leader peptide

    • Use inducible promoters to control expression levels

  • Evaluation metrics:

    • Respiratory growth on non-fermentable carbon sources

    • Quantification of mature vs. precursor COX2 forms by immunoblotting

    • Mitochondrial import efficiency assessed by subcellular fractionation

    • Cytochrome c oxidase activity measurements

  • Control conditions:

    • Wild-type COX2 expression

    • Empty vector controls

    • Δcox2 null mutant baseline

    • Temperature variations (standard and elevated)

What are the most informative methods for analyzing the incorporation of recombinant COX2 into functional cytochrome c oxidase complexes?

To comprehensively assess incorporation of recombinant COX2 into functional cytochrome c oxidase complexes, researchers should employ multiple complementary techniques:

Biochemical Assays:

  • Oxygen consumption measurements using high-resolution respirometry

  • Spectral analysis of assembled cytochrome c oxidase (absorption peaks at 442 nm and 604 nm)

  • In-gel activity staining after blue native PAGE separation

Structural Analysis:

  • Immunoprecipitation with antibodies against other complex IV subunits

  • Cryo-EM to visualize assembled complexes

  • Crosslinking mass spectrometry to map protein-protein interactions

Functional Readouts:

  • Membrane potential measurements using potentiometric dyes (JC-1, TMRM)

  • ATP synthesis rates in isolated mitochondria

  • Respiratory control ratios to assess coupling efficiency

A notable approach is to evaluate interaction with assembly factors, particularly COX12, which interacts with the copper chaperones required for CuA center formation in COX2. Recent studies suggest COX12 overexpression speeds copper delivery and assembly of the CuA center, facilitating the subsequent incorporation of allotopically expressed COX2 into the complete cytochrome c oxidase complex .

How can researchers effectively troubleshoot issues with recombinant COX2 expression and activity?

When troubleshooting recombinant COX2 expression and activity issues, systematically evaluate each step of the experimental workflow:

Expression Problems:

  • Low protein yield:

    • Optimize codon usage for the expression system

    • Check for potential toxicity (use inducible promoters)

    • Consider fusion tags to improve stability

    • For allotopic expression, evaluate targeting sequence efficiency

  • Aggregation/insolubility:

    • Reduce expression temperature

    • Modify hydrophobicity of transmembrane segments

    • Co-express with chaperones

    • For allotopic expression, note that excessive COX2 directed to mitochondria can aggregate at the mitochondrial surface

Activity Issues:

  • Poor enzymatic activity:

    • Assess copper center formation (copper supplementation experiments)

    • Verify proper assembly with other subunits

    • Check for improper post-translational modifications

    • Evaluate interaction with assembly factors (COA proteins)

  • Import failure in allotopic expression:

    • Confirm TMS1 hydrophobicity modifications are sufficient

    • Test co-expression with facilitating factors (TYE7, RAS2, or COX12)

    • Verify processing by mitochondrial proteases

    • Assess interaction with TIM23 translocase components

How can recombinant COX2 be utilized in disease models to study mitochondrial dysfunction?

Recombinant COX2 offers valuable approaches for studying mitochondrial dysfunction in disease models:

Disease Modeling Approaches:

  • Complementation studies: Express wild-type or mutant recombinant COX2 in cells harboring endogenous COX2 mutations to assess functional rescue.

  • Allotopic expression therapy models: Test nuclear-encoded COX2 variants as potential therapeutic approaches for mitochondrial DNA disorders, utilizing animal or cellular models.

  • Structure-function analysis: Introduce specific mutations corresponding to human pathological variants to elucidate molecular mechanisms of disease.

Relevant Disease Contexts:

  • Mitochondrial encephalomyopathies

  • Neurodegenerative disorders

  • Metabolic diseases

  • Cancer metabolism alterations

Research has shown that mutations in multiple COX assembly factors (SURF1, SCO1, SCO2, COX10, COX15, COX20, COA5, and LRPPRC) result in severe, often fatal metabolic disorders that primarily affect tissues with high energy demands, including brain, heart, and muscle . Recombinant COX2 can be used to study potential bypass mechanisms for these assembly defects.

What cutting-edge approaches are being developed for studying COX2 in the context of mitochondrial gene therapy?

Several innovative approaches are advancing the study of COX2 in mitochondrial gene therapy:

Allotopic Expression Optimization:
Current research focuses on optimizing the nuclear expression of mitochondrially-encoded genes like COX2. Key advances include:

  • Identification of specific amino acid substitutions (W56R, W56K, W56Q, or V49Q/L51G) that decrease TMS1 hydrophobicity

  • Discovery of genes that enhance mitochondrial import when overexpressed (TYE7, RAS2, COX12)

  • Development of optimized mitochondrial targeting sequences and leader peptide combinations

Novel Delivery Systems:

  • Engineered extracellular vesicles for targeted delivery

  • RNA-based approaches for transient expression

  • CRISPR-based technologies for mitochondrial genome editing

Advanced Monitoring Technologies:

  • Real-time imaging of import and assembly using fluorescent protein fusions

  • Single-molecule tracking of recombinant proteins

  • Nanoscale analysis of respiratory complex formation

Research in yeast models has demonstrated that allotopically expressed COX2 follows a different biogenesis pathway than mitochondrially synthesized COX2, entering mitochondria through the TOM translocator and subsequently being sorted by the TIM23 translocator. This knowledge provides critical insights for developing mitochondrial gene therapy approaches targeting human mitochondrial diseases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.