Recombinant Cytochrome c oxidase subunit 2 (cox-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
cox-2; coII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
cox-2
Target Protein Sequence
MNNFFQGYNLLFQHSLFASYMDWFHAFNCSLLLGVLVFVTLLFGYLIFSTFYFKSKKIEY QFGELLCSIFPTIILLMQMVPSLSLLYYYGLMNLDSNLTVKVTGHQWYWSYEYSDIPGLE FDSYMKSLDQLNLGEPRLLEVDNRCVIPCDTNIRFCITSADVIHAWALNSLSVKLDAMSG ILSTFSYSFPMVGVFYGQCSEICGANHSFMPIALEVTLLDNFKSWCFGTME
Uniprot No.

Target Background

Function
Recombinant Cytochrome c oxidase subunit 2 (COX-2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multisubunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Database Links

KEGG: cbr:COX2

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and sequence characteristics of human COX2?

Human Cytochrome c oxidase subunit 2 (COX2) is a relatively small protein with a predicted molecular mass of approximately 19.5-20 kDa and consists of 227 amino acid residues . The protein has an isoelectric point of approximately 4.5, indicating it carries a net negative charge at physiological pH . The full amino acid sequence of recombinant human COX2 includes specific membrane-spanning regions, with the first N-terminal membrane-spanning region being particularly important for its function and assembly within the cytochrome c oxidase complex . The protein sequence of COX2 is highly conserved across species, which reflects its crucial role in cellular respiration and energy production. Structurally, COX2 contains copper binding sites, particularly the CuA center, which is essential for its electron transfer function within the cytochrome c oxidase complex . The protein is anchored to the inner mitochondrial membrane, with specific domains extending into the intermembrane space to facilitate interaction with its electron donor, cytochrome c. X-ray crystallography studies have shown that COX2 interacts closely with other subunits, particularly COX1, which is necessary for the stabilization of the entire complex and proper binding of prosthetic groups such as heme a3 .

In which tissues is COX2 predominantly expressed and why?

The expression of COX2 predominantly occurs in tissues with high metabolic activity such as the heart muscle and brain where energetic demands are substantial . This tissue-specific expression pattern correlates directly with the energy requirements of these tissues, as they depend heavily on efficient oxidative phosphorylation for ATP production. The heart, being a continuously active muscle, requires constant energy production to maintain its contractile function, while the brain, despite accounting for only 2% of body weight, consumes approximately 20% of the body's oxygen and 25% of its glucose. These high-energy demands necessitate robust expression of components of the electron transport chain, including COX2. Tissues with lower metabolic rates generally express lower levels of COX2, consistent with their reduced requirements for oxidative phosphorylation. The differential expression of COX2 across various tissues also suggests potential tissue-specific regulatory mechanisms that control its expression in response to changing metabolic demands. Understanding these expression patterns is essential for researchers investigating mitochondrial function in different physiological and pathological contexts, as alterations in COX2 expression may contribute to tissue-specific manifestations of mitochondrial diseases.

How do mutations in COX2 affect cytochrome c oxidase assembly and function?

Mutations in the COX2 gene can have profound effects on cytochrome c oxidase assembly and function, often leading to severe biochemical deficiencies. Research has shown that missense mutations in COX2 can destabilize not only the COX2 subunit itself but also affect the stability and assembly of other subunits within the complex . For instance, a missense mutation changing a methionine to a lysine residue in the first N-terminal membrane-spanning region of COX2 resulted in a severe reduction in immunoblot cross-reactivity for multiple subunits, including COX III and nuclear-encoded subunits Vb, VIa, VIb, and VIc . This suggests that the structural integrity of COX2 is critical for the proper assembly of the entire cytochrome c oxidase complex. Furthermore, mutations in COX2 can disrupt the structural association between COX2 and COX1, which is necessary for stabilizing the binding of heme a3 to COX1, as demonstrated by spectrophotometric analysis revealing a dramatic decrease in COX I–associated heme a3 levels in mutant cells . Such disruptions in the assembly process ultimately compromise the electron transfer function of the enzyme, reducing its capacity to catalyze the reduction of oxygen to water. The catalytic inefficiency resulting from COX2 mutations can lead to increased production of reactive oxygen species, further exacerbating cellular damage and contributing to the pathogenesis of mitochondrial disorders.

What are the mechanisms regulating cytochrome c oxidase activity through COX2 modulation?

The regulation of cytochrome c oxidase activity through COX2 modulation involves several sophisticated mechanisms that fine-tune enzyme function in response to cellular needs. Research in Saccharomyces cerevisiae has identified regulatory proteins such as respiratory supercomplex factor 1 (Rcf1) that bind to intact cytochrome c oxidase and modulate its activity . Removal of Rcf1 has been shown to yield two distinct subpopulations of cytochrome c oxidase; one subpopulation maintains normal functional behavior similar to the wild-type enzyme, while the other displays decreased activity and accelerated ligand-binding kinetics . This alteration in function is associated with a lowered midpoint potential of the catalytic site in the affected subpopulation, suggesting that regulatory proteins can influence the redox properties of COX2 and consequently the enzyme's activity. There appear to be mechanisms that regulate oxygen binding and trapping in cytochrome c oxidase through modifications of COX2, thereby altering energy conservation by the enzyme . Additionally, post-translational modifications of COX2, including phosphorylation and acetylation, may play roles in regulating enzyme activity in response to changing metabolic conditions. The interaction between COX2 and other proteins within respiratory supercomplexes also represents a level of regulation that optimizes electron transfer efficiency and minimizes the production of reactive oxygen species during oxidative phosphorylation.

How can COX2 be utilized in evolutionary studies and phylogenetic analyses?

Cytochrome c oxidase subunit 2 (COX2) has proven to be a valuable genetic marker for evolutionary studies and phylogenetic analyses due to its essential function and sequence conservation across species. Researchers have examined the evolution of COX2 in various eutherian mammal orders, with special emphasis on orders such as Artiodactyla and Rodentia, to elucidate evolutionary relationships . When analyzed using both maximum parsimony, with either equal or unequal character weighting, and neighbor joining methods, COX2 provides insights into phylogenetic relationships, although it does not always perform with a high degree of consistency in terms of the phylogenetic hypotheses supported . The phylogenetic inconsistencies observed for COX2 may result from several factors, including differences in the rate of nucleotide substitution among particular lineages (especially between orders), base composition bias, transition/transversion bias, differences in codon usage, and different constraints and levels of homoplasy associated with first, second, and third codon positions . Despite these limitations, comparative analyses of COX2 sequences continue to contribute significantly to our understanding of mammalian evolution, particularly when used in conjunction with other molecular markers. The relatively slow rate of sequence evolution in functionally constrained regions of COX2 makes it particularly useful for resolving relationships among more distantly related taxa, while faster-evolving regions can help resolve relationships among closely related species.

What are the optimal expression systems for producing recombinant COX2?

Several expression systems have been successfully employed for producing recombinant Cytochrome c oxidase subunit 2 (COX2), each with distinct advantages depending on the research objectives. Escherichia coli expression systems have been widely used due to their simplicity, rapid growth, and high protein yield . For instance, COX2 has been successfully expressed using the pET-32a vector in E. coli Transetta (DE3) expression system induced by isopropyl β-d-thiogalactopyranoside (IPTG) . This prokaryotic system can produce recombinant human COX2 with a molecular mass of approximately 20 kDa, often incorporating affinity tags such as N-terminal His-tags to facilitate purification . Alternatively, wheat germ cell-free expression systems have been employed to produce recombinant human COX2 in the 1 to 75 amino acid range, which may be particularly suitable for applications such as ELISA and Western blotting . The wheat germ system offers advantages for expressing membrane proteins like COX2 as it provides a eukaryotic translation environment that may better support proper folding. For research requiring post-translational modifications or studying interaction with other mitochondrial proteins, mammalian or insect cell expression systems might be preferable despite their higher cost and complexity. Each expression system requires optimization of multiple parameters including expression vector design, codon optimization, induction conditions, and purification strategies to maximize the yield of functional recombinant COX2.

How can researchers effectively purify recombinant COX2 while maintaining its functional integrity?

Effective purification of recombinant Cytochrome c oxidase subunit 2 (COX2) while preserving its functional integrity requires careful consideration of both the protein's properties and the intended downstream applications. Affinity chromatography using Ni²⁺-NTA agarose has proven successful for purifying His-tagged recombinant COX2, resulting in purification levels exceeding 95% purity . During purification, it is crucial to maintain appropriate buffer conditions; typically, researchers utilize phosphate-buffered saline (PBS) at pH 7.4, often supplemented with stabilizing agents such as trehalose (5%) and small amounts of detergents (0.01% SKL) to prevent protein aggregation while preserving the native conformation of this membrane protein . Following elution from affinity columns, researchers should immediately assess protein concentration and consider implementing buffer exchange procedures to remove potentially interfering components such as imidazole, which can affect downstream functional assays. For long-term storage, lyophilization (freeze-drying) has been successfully employed, with reconstitution protocols recommending using 10mM PBS (pH 7.4) to achieve concentrations between 0.1-1.0 mg/mL without vortexing, which could damage the protein structure . Size exclusion chromatography may be incorporated as a polishing step to separate properly folded monomeric COX2 from aggregates or improperly folded species. Throughout the purification process, maintaining cold temperatures (2-8°C) and avoiding repeated freeze-thaw cycles are essential practices to preserve the functional integrity of the purified recombinant COX2, particularly when intended for enzymatic activity assays or structural studies.

What functional assays can be used to verify the activity of recombinant COX2?

Several functional assays can be employed to verify the activity of recombinant Cytochrome c oxidase subunit 2 (COX2), with each approach providing unique insights into different aspects of protein functionality. Spectrophotometric assays measuring the oxidation of reduced cytochrome c represent a primary method for assessing COX2 activity, as this directly evaluates the protein's electron transfer capability . In this assay, researchers monitor the decrease in absorbance at approximately 550 nm, which corresponds to the oxidation of reduced cytochrome c, with the rate of this reaction indicating the activity level of the recombinant COX2. UV-spectrophotometer analysis has successfully demonstrated that recombinant COX2 can catalyze the oxidation of substrate cytochrome c, confirming its functional integrity following recombinant expression and purification . Additionally, infrared spectrometer analysis can provide complementary information about the protein's catalytic function and has been used to study how various compounds, such as allyl isothiocyanate (AITC), influence COX2 activity . Oxygen consumption assays using oxygen electrodes or fluorescence-based oxygen sensing systems offer another approach to evaluate COX2 function by directly measuring the reduction of oxygen to water. For more detailed mechanistic studies, researchers may employ stopped-flow spectroscopy to analyze the kinetics of electron transfer and ligand binding to heme groups associated with the cytochrome c oxidase complex, providing insights into how recombinant COX2 contributes to these processes .

What factors should be considered when designing experiments involving recombinant COX2?

When designing experiments involving recombinant Cytochrome c oxidase subunit 2 (COX2), researchers must carefully consider multiple factors to ensure reliable and reproducible results. First, the choice of expression system significantly impacts the properties of the recombinant protein; while prokaryotic systems like E. coli offer high yields, they lack the machinery for post-translational modifications that may be crucial for certain aspects of COX2 function, whereas wheat germ cell-free systems may better preserve structural integrity for specific applications . Second, researchers must consider the inclusion and position of affinity tags (such as His-tags), as these can facilitate purification but potentially interfere with function or interaction studies; when possible, tag removal options should be incorporated into experimental designs. Third, buffer composition and pH require careful optimization, as COX2 is a membrane protein with specific requirements for maintaining its native conformation; PBS at pH 7.4 containing small amounts of stabilizing agents like trehalose (5%) has been successfully employed . Fourth, storage conditions significantly impact protein stability; researchers should establish appropriate protocols for avoiding repeated freeze-thaw cycles and consider lyophilization for long-term storage. Fifth, experimental controls must be rigorously implemented, including wild-type protein comparisons and verification of protein purity through multiple methods such as SDS-PAGE and Western blotting . Finally, researchers should consider the biological context when interpreting results, recognizing that COX2 naturally functions as part of a multi-subunit complex and its activity may be influenced by interactions with other proteins, such as respiratory supercomplex factors, which should be accounted for in experimental design and data analysis .

How can researchers accurately assess the antigenicity and immunological properties of recombinant COX2?

Accurately assessing the antigenicity and immunological properties of recombinant Cytochrome c oxidase subunit 2 (COX2) requires a multifaceted approach combining computational predictions with experimental validation. Initially, researchers can utilize various B-cell epitope prediction methods to analyze the COX2 protein sequence and identify regions with potentially high antigenicity . These computational approaches help identify regions of maximal hydrophilicity, which are likely to be antigenic sites, as the terminal regions of antigen proteins are often solvent accessible and unstructured, making them recognizable by antibodies even in the native protein . Following in silico predictions, experimental verification through enzyme-linked immunosorbent assays (ELISA) can quantitatively measure antibody binding to the recombinant COX2, providing direct evidence of antigenicity. Western blotting experiments using antibodies raised against recombinant COX2 can assess cross-reactivity with native protein in cellular extracts, confirming that the recombinant protein shares immunological properties with its endogenous counterpart . For more detailed epitope mapping, researchers can employ techniques such as peptide scanning, where overlapping peptides covering the entire COX2 sequence are synthesized and tested for antibody binding to precisely locate immunodominant regions. Flow cytometry and immunofluorescence microscopy using antibodies against recombinant COX2 can evaluate cellular localization and accessibility of epitopes in fixed or permeabilized cells. Finally, functional immunological assays such as neutralization tests or cell-mediated immunity assays may be necessary to fully characterize the immunological properties of recombinant COX2, particularly when considering its potential applications in vaccine development research .

What considerations are important when studying COX2 interactions with regulatory proteins?

When studying interactions between Cytochrome c oxidase subunit 2 (COX2) and regulatory proteins, researchers must address several critical considerations to ensure meaningful results. First, the experimental system should maintain the native membrane environment whenever possible, as COX2 is a membrane protein whose conformation and interaction capabilities are heavily influenced by its lipid surroundings; detergent solubilization protocols must be carefully optimized to preserve protein-protein interaction interfaces. Second, researchers should consider using multiple complementary interaction detection methods, including co-immunoprecipitation, pull-down assays with tagged recombinant proteins, crosslinking studies, and more sophisticated techniques such as surface plasmon resonance or isothermal titration calorimetry to quantify binding kinetics and thermodynamics . Third, careful attention must be paid to the functional consequences of these interactions; as demonstrated with respiratory supercomplex factor 1 (Rcf1), removal of interacting proteins can yield distinct subpopulations of cytochrome c oxidase with altered functional properties, necessitating careful functional characterization alongside interaction studies . Fourth, researchers should consider potential regulatory modifications of both COX2 and its interacting partners that might modulate these interactions, such as phosphorylation, acetylation, or redox-dependent modifications. Fifth, contextual factors such as metabolic state, oxygen tension, and cellular energy demands may significantly influence these regulatory interactions and should be systematically varied to understand their physiological relevance. Finally, genetic approaches using knockout/knockdown models or site-directed mutagenesis of potential interaction interfaces provide powerful tools for validating and characterizing these regulatory interactions in cellular and in vivo contexts, allowing researchers to establish their biological significance in various physiological and pathological scenarios.

What are common challenges in recombinant COX2 expression and how can they be overcome?

Researchers frequently encounter several challenges when expressing recombinant Cytochrome c oxidase subunit 2 (COX2), each requiring specific strategies to overcome. One major challenge is protein insolubility and formation of inclusion bodies in bacterial expression systems, as COX2 is naturally a membrane protein with hydrophobic regions . This issue can be addressed by optimizing induction conditions (lower temperatures, reduced IPTG concentrations), incorporating solubility-enhancing fusion partners (such as thioredoxin, GST, or SUMO tags), or using specialized E. coli strains designed for membrane protein expression. Another common challenge is low expression yields, which can be improved through codon optimization for the expression host, using stronger promoters, or switching to expression systems with better compatibility for mitochondrial proteins, such as wheat germ cell-free systems that have been successfully employed for human COX2 expression . Protein misfolding represents a third significant challenge that may be mitigated by co-expressing molecular chaperones, incorporating additional disulfide isomerases, or utilizing eukaryotic expression systems that better recapitulate the natural folding environment for mitochondrial proteins. Degradation of recombinant COX2 during expression or purification can be reduced by including protease inhibitors throughout the purification process, using protease-deficient host strains, or optimizing buffer compositions to enhance protein stability. Finally, challenges in verifying protein functionality after purification can be addressed through carefully designed activity assays that account for COX2's role in the larger cytochrome c oxidase complex, potentially including reconstitution experiments with other subunits or using specific functional assays such as cytochrome c oxidation measurements .

How can researchers interpret conflicting data in COX2 phylogenetic and evolutionary studies?

When interpreting conflicting data in Cytochrome c oxidase subunit 2 (COX2) phylogenetic and evolutionary studies, researchers should employ a systematic approach that considers multiple methodological and biological factors. First, researchers should recognize that different phylogenetic analysis methods (such as maximum parsimony with equal or unequal character weighting, and neighbor joining) may yield inconsistent results, necessitating the application of multiple analytical approaches and careful comparison of their outcomes . Second, variations in the rate of nucleotide substitution among different lineages, particularly between orders, must be accounted for, potentially through the use of relaxed molecular clock models that allow substitution rates to vary across different branches of the phylogenetic tree . Third, base composition bias can significantly impact phylogenetic inference, and researchers should apply models that explicitly account for such biases or consider recoding strategies that reduce their influence on the analysis. Fourth, transition/transversion bias and differences in codon usage patterns across taxa can create artificial similarities or differences that confound phylogenetic inference; addressing these requires applying appropriate substitution models and potentially partitioning analyses by codon position . Fifth, varying evolutionary constraints on different regions of the COX2 gene mean that some portions may be more phylogenetically informative than others for specific taxonomic levels; researchers might consider conducting separate analyses for different functional domains of the protein. Finally, integration of COX2 data with evidence from other genes, morphological characteristics, or alternative molecular markers provides the most robust approach to resolving phylogenetic inconsistencies, as phylogenetic signal from any single gene may be insufficient to fully resolve evolutionary relationships, particularly for complex questions such as the potential polyphyly of taxonomic groups or interordinal relationships .

What emerging technologies might advance our understanding of COX2 structure and function?

Several emerging technologies hold tremendous promise for advancing our understanding of Cytochrome c oxidase subunit 2 (COX2) structure and function in the coming years. Cryo-electron microscopy (cryo-EM) is revolutionizing our ability to determine high-resolution structures of membrane protein complexes like cytochrome c oxidase without the need for crystallization, potentially revealing dynamic conformational states of COX2 during the catalytic cycle that have remained elusive with traditional structural biology approaches. Advanced computational methods, including molecular dynamics simulations utilizing specialized force fields for membrane proteins, can complement experimental structural data by modeling COX2 dynamics within lipid bilayers, electron transfer pathways, and interactions with regulatory proteins such as respiratory supercomplex factor 1 (Rcf1) . Single-molecule techniques, including fluorescence resonance energy transfer (FRET) and optical tweezers, may provide unprecedented insights into conformational changes and electron transfer events in individual cytochrome c oxidase complexes, bypassing the limitations of ensemble averaging in traditional biochemical assays. CRISPR-Cas9 genome editing technologies enable precise manipulation of COX2 in cellular and animal models, facilitating detailed structure-function studies and investigation of disease-associated mutations in physiologically relevant contexts . Advances in mass spectrometry-based proteomics, particularly top-down approaches and hydrogen-deuterium exchange mass spectrometry, offer powerful tools for identifying post-translational modifications of COX2 and mapping protein-protein interaction interfaces at amino acid resolution. Finally, emerging synthetic biology approaches, including de novo protein design and bioorthogonal chemistry, may enable construction of simplified model systems that recapitulate specific aspects of COX2 function, potentially leading to fundamental insights into the mechanisms of biological electron transfer and oxygen reduction that could inform both basic research and biomedical applications.

How might COX2 research contribute to understanding mitochondrial diseases and developing targeted therapies?

Research on Cytochrome c oxidase subunit 2 (COX2) holds significant potential for enhancing our understanding of mitochondrial diseases and developing targeted therapeutic interventions. Detailed characterization of how COX2 mutations affect cytochrome c oxidase assembly and function provides crucial insights into the molecular pathogenesis of mitochondrial disorders, as demonstrated by studies showing that even single missense mutations in COX2 can disrupt the structural association with COX1 and destabilize the entire enzyme complex . This mechanistic understanding may facilitate the development of small molecule compounds that act as pharmacological chaperones, potentially stabilizing mutant COX2 proteins and improving their incorporation into functional cytochrome c oxidase complexes. Recombinant COX2 expressed in various systems serves as an invaluable tool for high-throughput screening of such therapeutic candidates and testing their efficacy in restoring electron transfer function . Additionally, understanding the regulatory mechanisms controlling cytochrome c oxidase activity through modulation of COX2 and interacting proteins like Rcf1 may reveal novel therapeutic targets aimed at enhancing mitochondrial function in diseases characterized by energy metabolism deficiencies . The antigenicity studies of COX2 may inform the development of immunotherapeutic approaches or diagnostic tools for mitochondrial disorders with immune system involvement . As gene therapy technologies continue to advance, precise genetic correction of COX2 mutations becomes an increasingly viable therapeutic strategy for certain mitochondrial diseases. Furthermore, the detailed knowledge of COX2 structure-function relationships enables rational design of mitochondria-targeted compounds that can bypass specific defects in the electron transport chain or enhance the efficiency of remaining functional complexes, potentially alleviating symptoms in patients with partial cytochrome c oxidase deficiencies.

What are promising areas for interdisciplinary research involving COX2?

Interdisciplinary research involving Cytochrome c oxidase subunit 2 (COX2) presents numerous exciting opportunities at the intersection of multiple scientific domains. The interface between structural biology and computational modeling offers a particularly promising avenue, combining experimental techniques like cryo-electron microscopy with advanced computational simulations to elucidate the dynamic behavior of COX2 within the cytochrome c oxidase complex and its interactions with regulatory proteins . Bridging evolutionary biology with functional biochemistry provides another rich interdisciplinary space, where comparative analyses of COX2 across diverse species can reveal both conserved functional regions and lineage-specific adaptations, potentially linking structural variations to functional differences in cellular respiration across environments and taxonomic groups . The integration of immunology and vaccine development research with COX2 biology represents an emerging interdisciplinary area, building on findings about COX2 antigenicity and hydrophobicity to develop novel immunotherapeutic approaches or diagnostic tools . Systems biology approaches combining proteomics, metabolomics, and computational modeling could provide comprehensive insights into how COX2 function integrates with broader cellular metabolic networks and responds to changing energy demands or environmental stressors. The application of synthetic biology and bioengineering principles to COX2 research opens possibilities for creating artificial electron transport systems with enhanced efficiency or novel functionalities, potentially contributing to bioenergy applications or biomimetic catalysts for oxygen reduction. Finally, translational research connecting basic COX2 biology with clinical medicine represents a crucial interdisciplinary bridge, where findings about mutation effects and regulatory mechanisms can inform the development of diagnostic biomarkers and therapeutic interventions for mitochondrial disorders, neurodegenerative diseases, and other conditions involving bioenergetic dysfunction .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.