Recombinant Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
COX2; COXII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Cyanidium caldarium (Red alga)
Target Names
COX2
Target Protein Sequence
MKFFFFSFINYKVLNDAARPWQIGFQDPATPIMEGIVNLHHDIIFFLIIIIIFVSWILFR TLFLFNSKTNPVAYNFSHGTFIELLWTLTPSLVLIGIAVPSFALLYSIDEIIDPAITIKA VGRQWYWSYEYSDYVNEENEFLAFHSYILPEEDLELGQFRLLEVDNRIIIPVNTHIRIIV TGADVIHSWAVPSLGVKCDAIPGRLNQISFFIKREGIYYGQCSEICGVNHGFMPIVIEAV SFDDYIRWVQNKILD
Uniprot No.

Target Background

Function

Recombinant Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the CuA center of subunit 2 and heme a of subunit 1 to the active site in subunit 1, a binuclear center (BNC) comprising heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 (COX2) and how does it function in cellular respiration?

Cytochrome c oxidase subunit 2 (COX2) is one of the core components of cytochrome c oxidase (CcO), the terminal enzyme in the mitochondrial electron transport chain. COX2 plays a crucial role in cellular respiration by transferring electrons from cytochrome c to the bimetallic center of the catalytic subunit 1, ultimately facilitating the reduction of oxygen to water . This process is essential for generating the proton electrochemical gradient that drives ATP synthesis.

The molecular function of COX2 specifically involves the transfer of electrons via its binuclear copper A center. According to UniProt annotations, "Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1" .

How is COX2 different from COX-2 (Cyclooxygenase-2)?

Despite the similar abbreviations, COX2 (Cytochrome c oxidase subunit 2) and COX-2 (Cyclooxygenase-2) are entirely different proteins with distinct functions:

FeatureCOX2 (Cytochrome c oxidase subunit 2)COX-2 (Cyclooxygenase-2)
LocationMitochondrial inner membraneEndoplasmic reticulum, nuclear membrane
FunctionElectron transfer in respiratory chainProstaglandin synthesis
EncodingTypically mitochondrial DNA encodedNuclear DNA encoded
Role in diseaseMitochondrial disordersInflammation, pain, cancer
InhibitorsCyanide, carbon monoxideNSAIDs, COX-2 selective inhibitors

The confusion between these proteins is common in the literature. COX-2 (Cyclooxygenase-2) is involved in inflammation and is the target of certain pain medications . The original "COX-2 hypothesis" suggesting that COX-2 had purely pathophysiological functions has been found to be oversimplified, as COX-2 also plays important homeostatic roles in kidney development, female fertility, and cardiovascular function .

What are the most effective methods for producing recombinant COX2?

Producing functional recombinant COX2 presents significant challenges due to its hydrophobic nature and complex assembly requirements. Based on current research, the following methodological approaches have proven most effective:

  • Expression system selection: The E. coli Transetta (DE3) expression system has been successfully used for recombinant COX2 expression . The protein can be induced by isopropyl β-d-thiogalactopyranoside (IPTG).

  • Vector design: The pET-32a expression vector is suitable for COX2 expression, allowing for the addition of tags (such as 6-His) that facilitate purification .

  • Protein purification: Affinity chromatography using Ni²⁺-NTA agarose has been effective for purifying recombinant COX2 with a 6-His tag. This method has yielded purified protein at concentrations of approximately 50 μg/mL .

  • Verification methods: Western blotting and spectrophotometric analysis are essential for confirming the identity and functionality of the recombinant protein. Recombinant COX2 has been shown to have a molecular mass of approximately 44 kDa when expressed with fusion tags .

How can the functionality of recombinant COX2 be assessed?

Several complementary approaches can determine whether recombinant COX2 is functional:

  • Substrate oxidation assays: UV-spectrophotometry can measure the catalytic activity of recombinant COX2 by monitoring the oxidation of its substrate, cytochrome c .

  • Oxygen consumption measurements: Polarography using a Clark-type oxygen electrode can quantify the rate of oxygen consumption, which directly correlates with COX2 activity. TMPD (N,N,N′,N′-tetramethyl-p-phenylenediamine) can serve as an artificial electron donor that specifically measures COX activity .

  • In-gel activity assays: This technique allows visualization of active cytochrome c oxidase in native protein gels, enabling assessment of both monomeric complex IV and supercomplexes containing COX2 .

  • Spectroscopic analysis: Infrared spectroscopy can provide insights into the structural integrity and catalytic capabilities of recombinant COX2 .

What is allotopic expression of COX2 and why is it significant for research?

Allotopic expression refers to the artificial relocation of an organellar gene (typically mitochondrial) to the nucleus, with subsequent import of the encoded protein back into the organelle. For COX2, this process is particularly significant because:

  • Evolutionary significance: During evolution, many mitochondrial genes were transferred to the nucleus. COX2 has been naturally transferred to the nucleus in some organisms but remains mitochondrially encoded in others, making it an excellent model for studying gene transfer mechanisms .

  • Therapeutic potential: Allotopic expression could potentially address human mitochondrial diseases caused by mutations in mitochondrial DNA, as demonstrated by experiments showing that nuclear-encoded COX2 can rescue respiratory function in yeast lacking mitochondrial COX2 .

  • Fundamental research: The process provides insights into protein import mechanisms, membrane protein assembly, and mitochondrial biogenesis .

The first successful allotopic expression of COX2 was achieved in yeast, demonstrating that a nuclear-recoded COX2 gene could complement the respiratory defect of a cox2-null strain when the recombinant protein contained specific mutations .

What modifications are required for successful allotopic expression of COX2?

Successful allotopic expression of COX2 requires several specific modifications to facilitate import and assembly:

  • Mitochondrial targeting sequence (MTS): The addition of an appropriate MTS is essential for directing the cytosolically translated protein to mitochondria. Research has shown that MTSs derived from hydrophobic mitochondrial proteins (such as Oxa1 or Su9) are more effective than those from hydrophilic proteins like Cox4 .

  • Reduction of transmembrane domain hydrophobicity: A critical modification is the W56R mutation in the first transmembrane domain of Cox2, which decreases its hydrophobicity and facilitates import through the TIM23 complex . Other effective mutations include W56K, W56Q, or the double mutation V49Q/L51G .

  • Leader peptide inclusion: The natural 15-residue leader peptide of the yeast mitochondrial Cox2 precursor enhances proper insertion of the protein into the inner mitochondrial membrane .

  • Codon optimization: Nuclear recoding of the mitochondrial gene sequence is necessary to account for the different genetic codes used in the nucleus versus mitochondria .

Research has demonstrated that positively charged substitutions (like W56R) are more favorable than substitutions that only decrease hydrophobicity without adding charge .

How does the regulatory protein Rcf1 modulate COX2 activity?

The respiratory supercomplex factor 1 (Rcf1) in Saccharomyces cerevisiae plays a complex role in regulating cytochrome c oxidase activity:

  • Subpopulation regulation: Research has demonstrated that removal of Rcf1 results in two distinct COX2 subpopulations - one exhibiting normal functional behavior and another with altered properties, including decreased activity and accelerated ligand-binding kinetics .

  • Redox potential modulation: Rcf1 regulates the midpoint potential of the catalytic site in a subpopulation of COX. In the absence of Rcf1, this subpopulation displays a lowered midpoint potential, which affects oxygen binding and trapping efficiency .

  • Assembly factor role: While Rcf1 has been suggested to be an assembly factor for cytochrome c oxidase, research indicates that functional CcO can still be assembled without Rcf1, although in altered proportions .

This regulatory mechanism appears to modulate energy conservation by the enzyme through controlling oxygen binding efficiency, representing a potential physiological control point for respiratory chain activity .

What are the mechanisms of COX2 import and assembly during allotopic expression?

The allotopically produced Cox2 follows a distinct biogenesis pathway compared to mitochondrially synthesized Cox2:

  • Initial import: The Cox2 precursor enters mitochondria through the TOM (Translocase of the Outer Membrane) complex .

  • Matrix translocation: The W56R mutation is crucial for allowing the first transmembrane segment (TMS1) to be fully translocated into the mitochondrial matrix by the TIM23 (Translocase of the Inner Membrane) complex, overcoming the stop-transfer effect typically exerted by hydrophobic domains .

  • Processing steps:

    • The mitochondrial processing protease cleaves the MTS in the matrix

    • The Oxa1 insertase recognizes the leader peptide and inserts TMS1 into the inner membrane

    • Cox20 stabilizes TMS1 in the intermembrane space

    • The IMS-localized Imp1 protease removes the leader peptide

  • TMS2 insertion: The highly hydrophobic second transmembrane segment (TMS2) is retained by TIM23 and released laterally into the inner membrane, along with the C-terminal domain, which becomes exposed to the intermembrane space .

The final topology of the allotopically produced Cox2 is "N out-C out" (both N and C termini in the intermembrane space), matching the topology of the mitochondrially synthesized protein .

What is the relationship between COX2 mutations and disease?

Mutations in COX2 can lead to severe pathophysiological consequences:

  • Mitochondrial disease: A missense mutation in the COX2 gene can cause defects in cellular respiration. Research has documented a mutation that changes a methionine to a lysine in the first membrane-spanning region of COX2, resulting in severe reduction of multiple cytochrome c oxidase subunits .

  • Molecular consequences: The study of COX2 mutations has revealed that structural association between COX2 and COX1 is necessary for stabilizing the binding of heme a3 to COX1. When COX2 is mutated, spectrophotometric analysis shows dramatic decreases in COX1-associated heme a3 levels .

  • Therapeutic implications: Understanding the consequences of COX2 mutations provides insights into potential therapies. Allotopic expression research aims to overcome mitochondrial DNA mutations by expressing functional proteins from nuclear genes, offering a potential approach to treating certain mitochondrial diseases .

The cascade effect observed in COX2 mutations - where alteration of one subunit destabilizes multiple other subunits - highlights the complex interdependence of components in the respiratory chain complexes .

What are common challenges in recombinant COX2 expression and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant COX2:

  • Protein aggregation: The hydrophobic nature of COX2 can lead to aggregation during expression. Solutions include:

    • Using fusion partners that enhance solubility

    • Expressing at lower temperatures (16-25°C)

    • Adding mild detergents during extraction and purification

  • Low yield: Recombinant COX2 often produces limited quantities of functional protein. Strategies to improve yield include:

    • Optimizing codon usage for the expression host

    • Using stronger promoters or inducible systems

    • Extending expression time while maintaining lower temperatures

  • Improper folding: Membrane proteins like COX2 may not fold correctly in heterologous systems. Approaches to address this include:

    • Co-expression with chaperones

    • Expression in eukaryotic systems rather than prokaryotic ones

    • Inclusion of lipids or membrane mimetics during refolding

  • Reduced activity: Even when expressed, recombinant COX2 may show lower than expected activity. Enhancement methods include:

    • Ensuring proper incorporation of copper cofactors

    • Optimizing assay conditions, particularly the lipid environment

    • Co-expressing with other subunits of the complex

How can the functionality of allotopically expressed COX2 be improved?

Specific strategies have emerged from research to enhance the functionality of allotopically expressed COX2:

  • Dosage optimization: Excessive expression can be detrimental, leading to aggregation at the mitochondrial surface. Research has shown that moderate expression levels (using centromeric rather than multicopy plasmids) may be more effective .

  • Co-expression strategies: Overexpression of supporting factors can improve COX2 function:

    • TYE7 overexpression enhances respiratory growth at both normal and elevated temperatures

    • RAS2 overexpression improves growth under various conditions

    • COX12 overexpression is beneficial at normal temperatures

  • Import efficiency engineering: Further modifications to reduce hydrophobicity or enhance interactions with import machinery can be beneficial. The effectiveness of the W56R mutation suggests that other similar modifications in transmembrane domains might be worth exploring .

  • Membrane potential considerations: Since protein import depends on the mitochondrial membrane potential, steps to maintain robust membrane potential during expression can enhance import efficiency. This might include supplementation with substrates that support mitochondrial function or growth under conditions that promote respiratory rather than fermentative metabolism .

By implementing these strategies, researchers have achieved up to 60% of wild-type cytochrome c oxidase levels in systems using allotopically expressed Cox2 W56R .

What are the implications of COX2 research for mitochondrial disease treatment?

Advances in COX2 research offer promising avenues for treating mitochondrial diseases:

  • Gene therapy potential: Allotopic expression of mitochondrial genes like COX2 represents a potential therapeutic strategy for diseases caused by mitochondrial DNA mutations. The successful complementation of cox2-null yeast with nuclear-encoded COX2 provides proof-of-principle for this approach .

  • Precision medicine applications: Understanding the specific mutations that facilitate proper import and assembly of nuclear-encoded mitochondrial proteins could allow for personalized approaches to mitochondrial disease treatment, tailored to specific genetic defects .

  • Drug development targets: Research into factors that enhance COX2 import and assembly (like TYE7, RAS2, and COX12) may identify new drug targets that could improve mitochondrial function in disease states by boosting the efficiency of existing pathways .

  • Synthetic biology approaches: The development of a yeast strain entirely lacking the mitochondrial genome but possessing functional respiratory capacity through allotopic expression represents an ambitious goal that would provide powerful tools for mitochondrial medicine .

Current research suggests that while technical challenges remain, the allotopic expression approach has real potential for addressing certain mitochondrial diseases, particularly those involving mutations in genes like COX2 that have been successfully expressed from the nucleus in experimental systems .

What emerging technologies are advancing COX2 research?

Several cutting-edge technologies are accelerating progress in COX2 research:

  • CRISPR/Cas9 genome editing: Enables precise modification of nuclear and mitochondrial genomes to study COX2 function and test allotopic expression strategies .

  • Cryo-electron microscopy: Provides high-resolution structural insights into COX2 incorporation into the cytochrome c oxidase complex and its interactions with regulatory factors like Rcf1 .

  • Single-molecule techniques: Allow for the study of individual COX2 molecules during import and assembly, providing insights into the kinetics and efficiency of these processes .

  • Systems biology approaches: Integration of proteomics, transcriptomics, and metabolomics data to understand how COX2 function is regulated within the broader context of mitochondrial and cellular function .

  • Molecular docking and simulation: Computational approaches have been used to identify potential interaction sites between COX2 and other molecules, such as the finding that allyl isothiocyanate (AITC) forms a hydrogen bond with Leu-31 of COX2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.