Recombinant Cytochrome c oxidase subunit 2 (COXII)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Cytochrome c Oxidase Subunit 2 (COXII)

Recombinant Cytochrome c oxidase subunit 2 (COXII) is a crucial component of the mitochondrial cytochrome c oxidase (Cco) complex, which plays a pivotal role in the electron transport chain. This enzyme is responsible for the transfer of electrons from cytochrome c to oxygen, facilitating the production of ATP during oxidative phosphorylation. The recombinant form of COXII is produced through genetic engineering techniques, allowing for its expression in various host organisms such as bacteria.

Expression and Purification of Recombinant COXII

The expression of recombinant COXII is typically achieved by cloning the COXII gene into an expression vector such as pET-32a and inducing its expression in E. coli using isopropyl β-D-thiogalactopyranoside (IPTG) . Following expression, the recombinant protein is purified using affinity chromatography with Ni(2+)-NTA agarose due to the presence of the 6-His tag .

Enzymatic Activity of Recombinant COXII

Recombinant COXII retains its enzymatic activity, as demonstrated by its ability to catalyze the oxidation of cytochrome c. This activity can be influenced by compounds such as allyl isothiocyanate (AITC), which forms a hydrogen bond with specific residues in the COXII structure . Molecular docking studies have shown that a sulfur atom in AITC can form a hydrogen bond with Leu-31, suggesting potential sites for future mutagenesis studies .

Research Findings and Applications

The study of recombinant COXII has provided insights into its structure-function relationships and potential applications in biotechnology and medicine. For instance, understanding how COXII interacts with inhibitors like AITC can inform strategies for modulating mitochondrial function in various diseases.

Table 1: Characteristics of Recombinant COXII from Sitophilus zeamais

CharacteristicValue
Amino Acid Residues227
Molecular Mass (native)26.2 kDa
Molecular Mass (with 6-His tag)44 kDa
pI Value6.37
Expression HostE. coli
Purification MethodNi(2+)-NTA agarose affinity chromatography

Table 2: Enzymatic Activity of Recombinant COXII

SubstrateActivity
Cytochrome cCatalyzes oxidation
InhibitorAllyl isothiocyanate (AITC)
Binding SiteLeu-31

References Molecular cloning and expression analysis of cytochrome c oxidase subunit II from Sitophilus zeamais. Mutational Analysis of the Saccharomyces cerevisiae Cytochrome c Oxidase Complex. Cytochrome c Oxidase Biogenesis: New levels of Regulation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COXII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-210
Protein Length
full length protein
Species
Trypanosoma cruzi
Target Names
COXII
Target Protein Sequence
MSFILSFWMIFLIDSVIVLLSFVCFVCVWICVLLLSTVLFVTKINNIYCTWDFVSSKFVD TYWFVIGVMFIMCLLLRLCLLLYFGCLNFVSFDLCKVVGFQWYWVYFLFGETTIFSNLIL ESDYLVGDMRLLQCNHVLTLLSLVIYKLWVSAVDVIHSFTLASLGIKVDCIPGRCNEIIL FASNNATIYGQCSELCGVLHGFMPIVICFI
Uniprot No.

Target Background

Function

Recombinant Cytochrome c oxidase subunit 2 (COXII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the CuA center of subunit 2 and heme a of subunit 1 to the binuclear center (BNC) in subunit 1. This BNC, composed of heme a3 and CuB, reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of COXII and how does it function in mitochondrial respiration?

Cytochrome c oxidase subunit II (COXII) contains a dual core CuA active site and serves as one of the core subunits of mitochondrial Cytochrome c oxidase (Cco). This protein plays a critical role in the electron transport chain and cellular respiration. The structure typically includes copper-binding domains that facilitate electron transfer from cytochrome c to the catalytic center of the enzyme complex .

COXII's primary function involves catalyzing the oxidation of cytochrome c substrate. Research has demonstrated that the protein contains specific binding sites that enable this catalytic activity. For example, in Sitophilus zeamais, the COXII protein has a molecular mass of approximately 26.2 kDa with a pI value of 6.37, characteristics that contribute to its specific enzymatic functions .

Experimental analysis using UV-spectrophotometry and infrared spectrometry has confirmed that properly folded recombinant COXII maintains its ability to catalyze the oxidation of cytochrome c substrate, demonstrating the preservation of its functional properties even in recombinant systems .

What expression systems are most effective for producing functional recombinant COXII?

The selection of an appropriate expression system is crucial for obtaining functional recombinant COXII. Based on recent research findings, the E. coli Transetta (DE3) expression system has proven effective when combined with appropriate vectors such as pET-32a . The expression system should be carefully chosen based on:

  • Protein folding requirements

  • Post-translational modification needs

  • Expected yield

  • Downstream application requirements

Table 1.1. Comparison of Expression Systems for Recombinant COXII Production

Expression SystemAdvantagesDisadvantagesTypical YieldFunctional Activity
E. coli Transetta (DE3)Fast growth, high yield, IPTG inductionLimited post-translational modifications50 μg/mLHigh with proper folding
Yeast systemsBetter folding, some post-translational modificationsSlower growth than bacteria20-40 μg/mLModerate to high
Insect cellsMore complex post-translational modificationsMore complex maintenance15-30 μg/mLHigh
Mammalian cellsNative-like modificationsLow yield, expensive5-15 μg/mLVery high

For efficient expression in bacterial systems, induction with isopropyl β-d-thiogalactopyranoside (IPTG) has been successfully employed, resulting in concentrated fusion protein yields around 50 μg/mL . This approach is particularly useful when focusing on structural studies or initial characterization of the protein.

What purification strategies yield the highest purity and activity for recombinant COXII?

Purification of recombinant COXII requires strategies that maintain protein structure and function while achieving high purity. A multi-step purification approach is generally recommended:

Affinity chromatography using Ni²⁺-NTA agarose has proven effective for isolating His-tagged recombinant COXII proteins, as demonstrated in recent studies . This technique leverages the high affinity of histidine residues for nickel ions, allowing specific binding of the tagged protein while contaminants are washed away.

For optimal purification results, consider the following protocol steps:

  • Cell lysis under conditions that preserve protein structure

  • Initial clarification through centrifugation

  • Affinity chromatography with appropriate imidazole gradient

  • Size exclusion chromatography for higher purity if needed

  • Activity testing at each purification stage to monitor functional integrity

Western blotting analysis can confirm successful purification, with recombinant COXII fusion proteins typically appearing at predicted molecular weights (approximately 44 kDa for His-tagged versions) . Rigorous purification validation is essential before proceeding to functional or structural studies.

How can researchers validate the functional activity of purified recombinant COXII?

Validating functional activity is critical to ensure that purified recombinant COXII retains its native catalytic properties. Multiple complementary approaches should be employed:

  • Spectrophotometric enzyme assays: UV-spectrophotometry can measure the oxidation rate of cytochrome c substrate, providing quantitative data on enzyme activity .

  • Infrared spectrometry: This technique can detect structural characteristics associated with functional COXII and confirm its interaction with known substrates .

  • Comparative activity assessment: Comparing recombinant COXII activity with native enzyme provides important reference data.

Table 1.2. Enzymatic Activity Assessment Methods for Recombinant COXII

Assessment MethodMeasured ParameterAdvantagesLimitations
UV-spectrophotometryCytochrome c oxidation rateQuantitative, rapidIndirect measurement
Infrared spectrometryStructural conformationStructural insightsSpecialized equipment needed
Oxygen consumptionDirect electron transport activityPhysiologically relevantComplex setup required
Thermal stability assaysActivity retention after heat stressEvaluates stabilityNot a direct functional test

When designing validation experiments, include appropriate controls such as heat-inactivated enzyme and known inhibitors to establish specificity of the observed activity. These validation steps ensure that subsequent experiments using the recombinant protein will yield reliable and reproducible results.

What experimental designs are most appropriate for studying inhibitor interactions with recombinant COXII?

When investigating inhibitor interactions with recombinant COXII, the selection of appropriate experimental designs is critical for generating reliable and meaningful data. Randomization in experimental design is particularly important to avoid bias and establish a secure base for error estimation .

Several experimental approaches can be employed:

  • Dose-response studies: Implement a continuous variable design where inhibitor concentration varies systematically while COXII concentration remains constant. This approach allows for determination of IC₅₀ values and inhibition kinetics.

  • Competitive binding assays: Utilize a substitutive design where the total concentration of COXII and potential binding partners is kept constant, but their relative proportions are varied . This design measures the relative intensity of interactions between COXII and various binding partners.

  • Response-surface design: Vary both the relative proportion and absolute concentration of COXII and inhibitors . This comprehensive approach can measure both relative intensity and absolute strength of interactions, though adequate replication may be challenging.

For example, research with allyl isothiocyanate (AITC) employed molecular docking methods to identify binding interactions with COXII, revealing that a sulfur atom in AITC's structure forms a 2.9 Å hydrogen bond with Leu-31 on the COXII protein . This finding demonstrates how experimental and computational approaches can be combined to gain insights into inhibitor mechanisms.

How can researchers effectively integrate structural analysis and functional studies of recombinant COXII?

Integrating structural and functional analyses provides comprehensive understanding of recombinant COXII. This integration requires careful experimental planning and data correlation:

  • Structure-guided mutagenesis: Based on the identification of critical residues from structural studies, targeted mutations can be introduced to test functional hypotheses. For instance, after finding that Leu-31 forms hydrogen bonds with inhibitors like AITC , mutations at this position could confirm its role in inhibitor binding.

  • Correlation of structural features with enzymatic parameters: Design experiments that systematically measure how structural alterations affect kinetic parameters (Km, Vmax, kcat).

  • Multi-method structural characterization: Combine X-ray crystallography, cryo-EM, and computational modeling to develop a comprehensive structural understanding.

Table 2.1. Integration of Structural and Functional Analysis Methods

Structural MethodFunctional MethodIntegrated ApproachResearch Outcome
Molecular dockingEnzyme inhibition assaysIdentify binding sites and validate through inhibition studiesStructure-activity relationships
Site-directed mutagenesisActivity measurementsCreate mutations at predicted important sites and test functionValidation of structure-based hypotheses
Hydrogen-deuterium exchangeSubstrate binding assaysMap dynamic regions and correlate with substrate interactionsMechanism of substrate recognition
Thermal shift assaysStability measurementsTest how ligands affect protein stability and functionAllosteric regulation mechanisms

When designing these integrated approaches, carefully consider the replication, randomization, and independence of measurements to ensure statistical validity . The experimental designs should account for potential confounding variables and include appropriate controls.

What are the critical parameters for optimizing expression and purification of recombinant COXII for structural studies?

Structural studies of COXII require exceptionally pure, homogeneous, and correctly folded protein samples. Optimizing expression and purification for this purpose involves careful attention to several critical parameters:

  • Expression construct design:

    • Include affinity tags positioned to avoid interference with protein folding

    • Consider fusion partners that enhance solubility

    • Incorporate protease cleavage sites for tag removal when necessary

  • Expression conditions optimization:

    • Systematically test induction temperatures (typically lower temperatures improve folding)

    • Optimize inducer concentration and induction duration

    • Consider specialized strains that enhance disulfide bond formation or provide rare codons

  • Purification strategy refinement:

    • Implement multi-step purification protocols combining affinity, ion exchange, and size exclusion chromatography

    • Monitor sample homogeneity using dynamic light scattering or analytical ultracentrifugation

    • Assess protein stability under different buffer conditions using thermal shift assays

In a successful example, researchers expressed COXII in E. coli Transetta (DE3) using pET-32a vectors and IPTG induction, followed by affinity purification with Ni²⁺-NTA agarose to obtain pure recombinant protein for functional studies . For structural studies, additional purification steps and removal of fusion tags would likely be necessary.

How can researchers establish reliable enzyme kinetics models for recombinant COXII activity?

Establishing reliable enzyme kinetics models for recombinant COXII requires systematic approaches that account for the complex nature of this enzyme's activity. Researchers should consider:

  • Experimental design considerations:

    • Implement randomized block designs to control for batch effects in enzyme preparations

    • Ensure adequate replication at each substrate concentration

    • Include appropriate controls to account for non-enzymatic oxidation of cytochrome c

  • Kinetic model selection and validation:

    • Test multiple models beyond simple Michaelis-Menten kinetics, including allosteric models if appropriate

    • Validate models using goodness-of-fit tests and residual analysis

    • Consider global fitting approaches when analyzing inhibition patterns

A systematic approach to kinetic parameter determination should include:

Table 2.2. Experimental Design for COXII Kinetic Parameter Determination

ParameterExperimental ApproachData Analysis MethodValidation Approach
Km and VmaxVary substrate concentration across wide rangeNon-linear regressionLineweaver-Burk and Eadie-Hofstee plots
Substrate specificityCompare activity with different cytochrome c variantsComparative kinetic analysisStructure-based correlation
Inhibition constantsMeasure activity with varying inhibitor concentrationsDixon plots and IC₅₀ determinationMolecular docking correlation
pH and temperature optimaActivity measurements across pH and temperature rangesResponse surface modelingThermodynamic analysis

UV-spectrophotometric analysis and infrared spectrometry have been successfully used to characterize the catalytic activity of recombinant COXII proteins, such as their ability to oxidize cytochrome c substrates . These approaches provide quantitative data that can be incorporated into kinetic models.

What approaches are effective for studying COXII interactions with other mitochondrial complex components?

Studying interactions between recombinant COXII and other mitochondrial complex components requires specialized techniques that can capture transient or stable protein-protein interactions within the electron transport chain. Effective approaches include:

  • Co-immunoprecipitation studies:

    • Use antibodies against tagged recombinant COXII to pull down interaction partners

    • Implement stringent controls including IgG controls and reverse co-IP

    • Analyze results using mass spectrometry for unbiased interaction partner identification

  • Proximity labeling techniques:

    • Engineer COXII fusions with BioID or APEX2 enzymes

    • Identify proteins in close proximity to COXII through biotinylation patterns

    • Validate interactions through orthogonal methods

  • Reconstitution experiments:

    • Systematically incorporate purified components with recombinant COXII

    • Measure electron transfer rates or oxygen consumption

    • Determine the minimal components required for activity

When designing these interaction studies, careful consideration should be given to experimental controls and replication to ensure that observed interactions are biologically relevant and not experimental artifacts . The physical arrangement of replicates in space and their sampling through time significantly impacts the validity of the results.

How should researchers address potential artifacts in recombinant COXII studies?

When working with recombinant COXII, several artifacts can potentially confound research findings. A methodical approach to identifying and addressing these issues includes:

  • Expression system artifacts:

    • Compare results across multiple expression systems to identify system-specific artifacts

    • Validate findings with native COXII where possible

    • Consider how fusion tags might alter protein behavior

  • Purification-related artifacts:

    • Implement negative controls using mock purifications from non-expressing cells

    • Assess the impact of different purification methods on activity

    • Monitor protein aggregation state throughout purification

  • Functional assay artifacts:

    • Include substrate-only and enzyme-only controls

    • Account for buffer components that might affect spectrophotometric readings

    • Validate activity using multiple independent methods

Researchers investigating COXII have successfully addressed potential artifacts by employing careful experimental design, including the use of appropriate controls and validation through multiple analytical techniques such as Western blotting, UV-spectrophotometry, and infrared spectrometry . These approaches help distinguish genuine COXII activity from experimental artifacts.

What data reporting standards should be followed for recombinant COXII research?

Comprehensive data reporting is essential for reproducibility in recombinant COXII research. Researchers should adhere to these standards:

  • Expression and purification reporting:

    • Provide complete sequence information including any tags or mutations

    • Detail expression conditions (temperature, induction parameters, media composition)

    • Report purification protocol with buffer compositions and yields at each step

  • Activity assay reporting:

    • Specify exact assay conditions (temperature, pH, buffer composition)

    • Report enzyme concentration determination methods

    • Include raw data or representative traces in addition to processed results

  • Statistical analysis and experimental design reporting:

    • Clearly describe randomization procedures used in experiments

    • Report sample sizes, replicates, and statistical tests applied

    • Provide measures of variability for all quantitative data

Table 3.1. Essential Data Reporting Elements for Recombinant COXII Research

Research AspectEssential Reporting ElementsFormat Recommendation
Protein sequenceComplete amino acid sequence with modificationsFASTA format with annotations
Expression systemStrain, plasmid, induction parametersDetailed methods section with all critical parameters
Purification protocolStep-by-step procedure with all buffer compositionsFlow chart plus detailed text description
Activity measurementsRaw data, analysis methods, controlsTables plus representative plots
Statistical analysisTests performed, p-values, confidence intervalsFollow field-standard statistical reporting guidelines

Adherence to these reporting standards ensures that other researchers can evaluate and reproduce the findings, which is crucial for advancing the field of COXII research.

How can computational approaches enhance recombinant COXII research?

Computational approaches are increasingly valuable in recombinant COXII research, offering insights that complement experimental studies. Key computational approaches include:

  • Molecular docking and simulation:

    • Predict interactions between COXII and potential inhibitors

    • Simulate conformational changes during catalytic cycles

    • Identify potential binding sites for further experimental validation

Molecular docking has already proven valuable in COXII research, as demonstrated by the identification of a 2.9 Å hydrogen bond between the sulfur atom of allyl isothiocyanate (AITC) and Leu-31 of COXII . This computational finding provides mechanistic insights that can guide experimental design for inhibitor studies.

  • Machine learning applications:

    • Predict optimal expression conditions based on sequence features

    • Identify patterns in activity data that suggest mechanistic insights

    • Optimize purification protocols through systematic parameter exploration

  • Homology modeling and evolutionary analysis:

    • Compare COXII structures across species to identify conserved functional elements

    • Predict structural features when crystallographic data is unavailable

    • Identify co-evolving residues that may be functionally linked

When implementing computational approaches, researchers should validate predictions experimentally and report all parameters and methods used in computational studies to ensure reproducibility.

What are the recent methodological advances in studying recombinant COXII in membrane-mimetic systems?

Traditional studies of recombinant COXII often fail to account for its native membrane environment. Recent methodological advances to address this limitation include:

  • Nanodiscs and lipid bilayer systems:

    • Reconstitute purified COXII into nanodiscs with defined lipid composition

    • Measure activity in a near-native membrane environment

    • Study how lipid composition affects COXII function

  • Cryo-electron microscopy applications:

    • Visualize COXII structure in membrane environments

    • Capture different conformational states during the catalytic cycle

    • Determine interactions with other respiratory complex components

  • Native mass spectrometry approaches:

    • Analyze intact membrane protein complexes containing COXII

    • Determine subunit stoichiometry and stability

    • Identify small molecules or lipids that co-purify with the complex

These advanced methodologies provide more physiologically relevant contexts for studying COXII function and can reveal aspects of protein behavior that might be missed in traditional soluble protein studies. The integration of these approaches with traditional biochemical methods offers a more comprehensive understanding of COXII biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.