Recombinant Cytochrome c oxidase subunit 2 (ctaC)

Shipped with Ice Packs
In Stock

Description

Function of Cytochrome c Oxidase Subunit 2

The MT-CO2 gene provides the code for subunit 2 of cytochrome c oxidase, which is essential for the function of the enzyme . The Cytochrome c oxidase complex facilitates the transfer of electrons from cytochrome c to oxygen . COII is one of the three subunits responsible for the functional core of cytochrome c oxidase . This subunit plays an essential role in transferring electrons from cytochrome c to the catalytic subunit 1's bimetallic center using its binuclear copper A center .

Structure and Location

Cytochrome c oxidase is a large transmembrane protein complex with several metal prosthetic sites and multiple protein subunits . Subunit 2 has two transmembrane regions at its N-terminus, with the majority of the protein exposed to the periplasmic space or the mitochondrial intermembrane space . The substrate-binding site is located on MT-CO2, which also contains the binuclear copper A center, the primary electron acceptor in cytochrome c oxidase .

Gene and Protein Characteristics

The full-length cDNA of COXII has been cloned from Sitophilus zeamais, featuring an open reading frame (ORF) of 684 bp encoding 227 amino acids . The predicted COXII protein has a molecular mass of 26.2 kDa with a pI value of 6.37 . Sequence analysis reveals high sequence identity with the COXII of other insect species .

Recombinant COXII Production and Activity

Recombinant COXII with a 6-His tag can be purified using affinity chromatography with Ni(2+)-NTA agarose . Studies using UV-spectrophotometers and infrared spectrometers have demonstrated that recombinant COXII can catalyze the oxidation of the substrate Cytochrome C (Cyt c) . The recombinant protein, when expressed in E. coli, has a molecular weight of approximately 44 kD .

Cytochrome c Oxidase Subunits

The cytochrome c oxidase complex consists of several conserved subunits.

Table of Conserved Subunits of Cytochrome c Oxidase Complex

No.Subunit nameHuman proteinProtein description from UniProtPfam family with Human protein
1Cox1COX1_HUMANCytochrome c oxidase subunit 1Pfam PF00115
2Cox2COX2_HUMANCytochrome c oxidase subunit 2Pfam PF02790, Pfam PF00116
3Cox3COX3_HUMANCytochrome c oxidase subunit 3Pfam PF00510
4Cox4i1COX41_HUMANCytochrome c oxidase subunit 4 isoform 1, mitochondrialPfam PF02936
5Cox4a2COX42_HUMANCytochrome c oxidase subunit 4 isoform 2, mitochondrialPfam PF02936
6Cox5aCOX5A_HUMANCytochrome c oxidase subunit 5A, mitochondrialPfam PF02284
7Cox5bCOX5B_HUMANCytochrome c oxidase subunit 5B, mitochondrialPfam PF01215
8Cox6a1CX6A1_HUMANCytochrome c oxidase subunit 6A1, mitochondrialPfam PF02046
9Cox6a2CX6A2_HUMANCytochrome c oxidase subunit 6A2, mitochondrialPfam PF02046
10Cox6b1CX6B1_HUMANCytochrome c oxidase subunit 6B1Pfam PF02297
11Cox6b2CX6B2_HUMANCytochrome c oxidase subunit 6B2Pfam PF02297
12Cox6cCOX6C_HUMANCytochrome c oxidase subunit 6CPfam PF02937
13Cox7a1CX7A1_HUMANCytochrome c oxidase subunit 7A1, mitochondrialPfam PF02238
14Cox7a2CX7A2_HUMANCytochrome c oxidase subunit 7A2, mitochondrialPfam PF02238
15Cox7a3COX7S_HUMANPutative cytochrome c oxidase subunit 7A3, mitochondrialPfam PF02238
16Cox7bCOX7B_HUMANCytochrome c oxidase subunit 7B, mitochondrialPfam PF05392
17Cox7cCOX7C_HUMANCytochrome c oxidase subunit 7C, mitochondrialPfam PF02935
18Cox7rCOX7R_HUMANCytochrome c oxidase subunit 7A-related protein, mitochondrialPfam PF02238
19Cox8aCOX8A_HUMANCytochrome c oxidase subunit 8A, mitochondrial PPfam PF02285
20Cox8cCOX8C_HUMANCytochrome c oxidase subunit 8C, mitochondrialPfam PF02285

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
ctaC; coiI; ctaB; Cytochrome c oxidase subunit 2; Cytochrome aa3 subunit 2; Cytochrome c oxidase polypeptide II; Oxidase aa(3 subunit 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-280
Protein Length
Full Length of Mature Protein
Species
Paracoccus denitrificans
Target Names
ctaC
Target Protein Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRF NRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQ WYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVI HAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYE AWLAGAKEEFA
Uniprot No.

Target Background

Function

Subunits I and II constitute the enzyme complex's functional core. Electrons from cytochrome c are transferred via heme a and Cu(A) to the binuclear center comprising heme a3 and Cu(B).

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Cytochrome c oxidase subunit 2 (ctaC)?

Cytochrome c oxidase subunit 2 (ctaC) is a critical component of cytochrome caa3, which functions as a terminal enzyme in the respiratory electron transport chain. In Bacillus subtilis, ctaC has been conclusively demonstrated to be a lipoprotein with the N-terminal sequence exhibiting characteristic features of bacterial lipoproteins . The protein contains a cytochrome c domain with covalently bound heme that plays an essential role in electron transfer during oxidative phosphorylation. The functional protein integrates into the cell membrane, with its cytochrome c domain positioned on the outer side of the membrane where it can accept electrons from cytochrome c and transfer them to the catalytic center of the enzyme .

How does ctaC differ structurally and functionally from other cytochrome oxidase subunits?

While ctaC (subunit II of cytochrome caa3) functions in a terminal oxidase complex, it differs substantially from subunits in other oxidase types such as cbb3-type oxidases. For instance, in cbb3-type oxidases, the analogous electron transfer role is performed by the CcoO subunit, which contains one c-type heme and is membrane-anchored . Unlike ctaC, which is a lipoprotein requiring specific post-translational processing, CcoO partners with CcoN (the catalytic subunit containing b-type hemes) to form the functional core of cbb3-type oxidases . Furthermore, ctaC in B. subtilis is unique in being one of only four main proteins (alongside QcrC, QcrB, and CccA) that contain covalently bound heme in the membrane fraction .

What post-translational modifications are essential for ctaC functionality?

Research demonstrates that ctaC undergoes two critical post-translational modifications that impact its functionality:

  • Lipid modification: The protein is lipid-modified at its N-terminus by prolipoprotein diacylglyceryl transferase (Lgt).

  • Signal peptide cleavage: The signal peptide is removed by signal peptidase type II (Lsp).

Experimental evidence from B. subtilis mutants reveals that while covalent binding of heme to the cytochrome c domain occurs independently of these modifications, removal of the signal peptide is specifically required for the formation of functionally active enzyme . This indicates a complex maturation pathway where certain structural features can assemble without complete processing, but catalytic activity requires full maturation of the protein.

What are the most effective methods for detecting and quantifying ctaC expression in bacterial samples?

For robust detection and quantification of ctaC expression, a multi-method approach is recommended:

Radioactive Labeling Method:

  • Grow bacterial cells in the presence of radioactive 5-aminolevulinic acid (ALA), a heme biosynthetic precursor.

  • Isolate membrane fractions using ultracentrifugation.

  • Separate proteins using SDS-PAGE.

  • Visualize cytochrome c through autoradiography, as the covalently bound heme remains attached to the polypeptide despite SDS treatment .

Immunoblot Analysis Protocol:

  • Prepare membrane fractions from bacterial cultures.

  • Separate proteins using SDS-PAGE.

  • Transfer proteins to a membrane.

  • Probe with antibodies specific to the C-terminal peptide of ctaC.

  • Develop using appropriate secondary antibodies and detection systems .

Spectrophotometric Enzyme Activity Assay:

  • Isolate membrane fractions.

  • Measure cytochrome c oxidation activity spectrophotometrically.

  • Use reduced Saccharomyces cerevisiae cytochrome c (20 μM) as substrate.

  • Calculate activity as μmol of cytochrome c oxidized per mg of membrane protein per minute .

How can researchers effectively generate and validate ctaC mutants for functional studies?

To generate and validate ctaC mutants for functional studies, follow this comprehensive approach:

Generation Strategy:

  • Design mutation strategies targeting specific domains (signal sequence, transmembrane domain, or cytochrome c domain).

  • For processing mutants, target genes in the post-translational modification pathway (lgt for lipid modification, lsp for signal peptide cleavage).

  • Use allelic replacement techniques to introduce mutations into the chromosome or complementation with plasmid-borne mutant alleles.

Validation Protocol:

  • Genetic verification: Confirm mutations by PCR and sequencing.

  • Protein expression analysis: Use immunoblotting to verify expression levels and apparent molecular weight (wild-type ctaC appears at ~38 kDa while unprocessed forms in lsp mutants appear at ~40 kDa) .

  • Heme incorporation: Verify cytochrome c domain assembly by radioactive labeling with [14C]ALA followed by SDS-PAGE and autoradiography .

  • Subcellular localization: Confirm membrane association through fractionation studies.

  • Functional assessment: Measure cytochrome c oxidase activity spectrophotometrically using reduced cytochrome c as a substrate .

Strain TypeRelative Molecular WeightSignal Peptide StatusLipid ModificationCytochrome c Oxidase ActivityHeme Binding
Wild-type38 kDaCleavedPresent100%Normal
Lgt-deficient38 kDa + 39 kDaPartially cleavedAbsent26% ± 8%Normal
Lsp-deficient40 kDaUncleavedPresent5% ± 2%Normal

What experimental controls are critical when studying recombinant ctaC expression systems?

When establishing recombinant ctaC expression systems, the following controls are essential:

Essential Control Panel:

  • Empty vector control: To establish baseline expression and exclude effects from the expression system itself.

  • Wild-type ctaC expression: Serves as positive control for proper protein processing and functionality.

  • Non-functional ctaC mutant: A variant with documented loss of function helps validate assay sensitivity.

  • Processing pathway controls: Include strains with mutations in lgt and lsp genes to distinguish effects of different post-translational modifications .

  • Cytochrome caa3-deficient control: A strain completely lacking cytochrome caa3 (e.g., through deletion of catalytic subunits) serves as a negative control for activity assays .

Validation Measurements:

  • Monitor growth rates under different respiratory conditions

  • Compare cytochrome c oxidase activity levels

  • Analyze membrane-bound cytochrome content spectrophotometrically

  • Verify protein expression through immunoblotting

  • Confirm proper heme incorporation using radioactive labeling

How should researchers address data contradictions in ctaC localization and assembly studies?

When confronting contradictory data regarding ctaC localization and assembly, researchers should implement a systematic approach:

Contradiction Resolution Framework:

  • Validate experimental techniques: Ensure that membrane fractionation procedures are consistent and appropriate for the organism studied.

  • Cross-reference multiple detection methods: Compare results from immunoblotting, radioactive labeling, and spectroscopic analyses to identify technical artifacts .

  • Consider proteolytic processing: Examine the presence of cleavage products, such as the 28 kDa fragment observed in some studies, which may represent truncated but membrane-associated forms of ctaC .

  • Evaluate transfer efficiency: Note that different forms of ctaC (e.g., the 40-kDa unprocessed form) may transfer from gels to membranes with varying efficiency during immunoblotting, potentially leading to misinterpretation of relative quantities .

  • Implement consistency checks: Use parallel detection methods on the same samples, such as combining autoradiography with immunoblotting to verify that observed patterns represent the same protein population .

What statistical approaches are most appropriate for analyzing ctaC activity data across different mutant strains?

When analyzing cytochrome c oxidase activity data across wild-type and mutant strains, consider these statistical best practices:

Statistical Analysis Protocol:

  • Replicate design: Use a minimum of three biological replicates and three technical replicates per condition.

  • Normalization strategy: Express activity as a percentage of wild-type activity to allow comparison across experimental batches.

  • Error reporting: Present data with standard deviation or standard error of the mean as appropriate (e.g., 26% ± 8% activity for Lgt-deficient mutants) .

  • Statistical testing: Apply appropriate tests (e.g., ANOVA with post-hoc tests) to determine significance of differences between strains.

  • Correlation analysis: Examine relationships between protein expression levels (quantified from immunoblots) and enzyme activity to identify potential threshold effects.

A comprehensive statistical approach should include:

  • Testing for normal distribution of data

  • Assessment of homogeneity of variance

  • Application of parametric or non-parametric tests as appropriate

  • Correction for multiple comparisons when testing numerous mutant strains

How can researchers effectively distinguish between direct and indirect effects when interpreting ctaC mutant phenotypes?

Distinguishing direct from indirect effects in ctaC mutant studies requires a multi-faceted approach:

Differentiation Strategy:

  • Complementation testing: Reintroduce wild-type ctaC on a plasmid to confirm phenotype rescue.

  • Domain-specific mutations: Create targeted mutations affecting specific functions rather than null mutations.

  • Epistasis analysis: Examine double mutants combining ctaC mutations with mutations in interacting partners or assembly factors.

  • Temporal analysis: Monitor the progression of defects during cell growth to distinguish primary from secondary effects.

  • Comparative analysis: Contrast phenotypes with those of mutants in other cytochrome oxidase subunits to identify subunit-specific versus general assembly defects.

Analysis of Indirect Effects in Processing Mutants:
Data from processing pathway mutants (Lgt- and Lsp-deficient) demonstrate that while both show impaired cytochrome caa3 activity, the mechanisms differ. The Lsp-deficient mutant (with uncleaved signal peptide) retains only 5% activity despite normal heme binding, suggesting that signal peptide removal is critical for a post-assembly activation step rather than the initial protein folding or heme incorporation .

What is the relationship between ctaC processing and cytochrome caa3 enzyme activity in different bacterial species?

The relationship between ctaC processing and cytochrome caa3 activity shows both conserved and species-specific patterns:

Processing-Activity Relationship:
In B. subtilis, research demonstrates that enzyme activity is significantly impacted by processing defects, with specific contributions from different modification steps:

  • Signal peptide cleavage: The most critical step for activity, as Lsp-deficient mutants (which cannot cleave the signal peptide) retain only 5% of wild-type activity despite normal heme incorporation .

  • Lipid modification: Important but less critical than signal peptide cleavage, as Lgt-deficient mutants (lacking lipid modification) maintain 26% of wild-type activity .

This pattern suggests that while the cytochrome c domain can fold and incorporate heme independently of N-terminal processing, signal peptide removal is essential for establishing proper structural conformation or interactions within the complete cytochrome caa3 complex. This finding has significant implications for studies in other bacterial species, where the processing machinery may differ in specificity or efficiency.

How do researchers effectively distinguish between different cytochrome c oxidase isoforms in experimental systems?

Distinguishing between cytochrome c oxidase isoforms requires a combination of biochemical, spectroscopic, and genetic approaches:

Isoform Differentiation Protocol:

  • Spectroscopic fingerprinting:

    • Measure reduced minus oxidized difference spectra

    • Cytochrome caa3 shows characteristic absorption at 605 nm in ascorbate- or dithionite-reduced minus ferricyanide-oxidized difference spectra

    • Compare with absorption peaks of other terminal oxidases (e.g., cytochrome bd or bo)

  • Substrate specificity analysis:

    • Test oxidation rates with different electron donors (e.g., mammalian vs. yeast cytochrome c)

    • Determine kinetic parameters (Km, Vmax) for each substrate

    • Compare inhibition profiles with oxidase-specific inhibitors

  • Genetic verification:

    • Use knockout strains for specific oxidase subunits

    • Verify loss of specific spectroscopic signals in these strains

    • Perform genetic complementation to confirm specificity

  • SDS-PAGE mobility:

    • Analyze apparent molecular weights of cytochrome c-containing subunits

    • CtaC typically appears at 38 kDa (mature) or 40 kDa (unprocessed) in B. subtilis

    • Compare with other c-type cytochromes such as QcrC, QcrB, and CccA

What methodological approaches are most effective for studying ctaC interactions with other respiratory chain components?

To investigate ctaC interactions with other respiratory chain components, researchers should employ these methodological approaches:

Interaction Study Framework:

  • Co-immunoprecipitation protocol:

    • Generate antibodies against ctaC or epitope-tag the protein

    • Solubilize membrane complexes using mild detergents

    • Immunoprecipitate ctaC and identify interacting partners by mass spectrometry

    • Verify interactions by reciprocal co-immunoprecipitation

  • Blue native PAGE analysis:

    • Solubilize membrane complexes under non-denaturing conditions

    • Separate intact respiratory complexes

    • Identify complex components through second-dimension SDS-PAGE or mass spectrometry

    • Compare complex assembly in wild-type versus processing mutants

  • Crosslinking studies:

    • Apply membrane-permeable crosslinkers to living cells

    • Isolate crosslinked complexes

    • Identify crosslinked products by immunoblotting or mass spectrometry

    • Map interaction domains through analysis of crosslinked peptides

  • Fluorescence resonance energy transfer (FRET):

    • Generate fluorescent fusion proteins for ctaC and potential partners

    • Monitor energy transfer in living cells as indication of protein proximity

    • Validate interactions through controls for non-specific association

These approaches collectively provide a comprehensive picture of ctaC's integration within the respiratory chain and how post-translational modifications affect its interactions with other components.

What are the most promising avenues for future research on ctaC structure and function?

Several high-potential research directions emerge from current knowledge of ctaC:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.