Recombinant Cytochrome c oxidase subunit 3 (cox-3)

Shipped with Ice Packs
In Stock

Description

Molecular Architecture

COX3 is a multi-pass transmembrane protein with seven transmembrane domains in humans . It lacks prosthetic groups (e.g., heme or copper centers) but interacts with COX1 and COX2 to stabilize the catalytic core . In bacterial COX, COX3 modulates proton transfer through subunits 1 and 2, suggesting a conserved role in enzyme dynamics .

ParameterHuman COX3Bacterial COX3
Genetic OriginMitochondrial DNA (MT-CO3) Chromosomal DNA
Subcellular LocationInner mitochondrial membrane Plasma membrane
Transmembrane Domains7 α-helices Variable (depends on species)

Catalytic Role

COX3 does not directly participate in electron transfer but contributes to:

  • Enzyme Stability: Maintains the structural integrity of the COX1-COX2 complex .

  • Oxygen Access: Modulates the biophysical environment for oxygen binding at the COX1-COX2 active site .

  • Proton Transfer: Facilitates proton pumping in bacterial COX .

Production Systems

Recombinant COX3 is synthesized via heterologous expression in host systems such as:

Host SystemAdvantagesPurity
E. coliHigh yield, cost-effective≥85% (SDS-PAGE)
YeastProper post-translational modifications≥85% (SDS-PAGE)
Baculovirus/MammalianNative-like folding and membrane integrationVariable (case-dependent)

Recombinant COX3 from Oryza sativa (rice) has a molecular weight of 29,358 Da and retains catalytic activity (EC 1.9.3.1) .

Key Applications

  1. Structural Studies:

    • X-ray crystallography to resolve COX3 interactions with COX1/COX2 .

    • Functional assays to test metal center biogenesis (e.g., Cu A and Cu B site assembly) .

  2. Disease Modeling:

    • Knockout (KO) models in human cells reveal COX3’s role in complex IV assembly. COX19-KO cells show undetectable COX2 and COX3, impairing respiration .

  3. Diagnostic Tools:

    • ELISA kits enable quantitative measurement of COX3 in biological samples (e.g., tissue homogenates) .

Metal Center Biogenesis

COX3 interacts with chaperones like COX11 and SCO1/2 to coordinate copper delivery to the COX1-COX2 complex :

  • Cu A Site (COX2): Requires COX19 and PET191 for proper metallation .

  • Cu B Site (COX1): COX11 facilitates copper insertion, with PET191 regulating redox states of assembly factors .

ChaperoneRoleKO Phenotype
COX11Binds Cu(I) and transfers to COX150% COX1, 15% COX2; residual COX activity
COX19Stabilizes COX1 and promotes assemblyUndetectable COX2; no COX activity

Disease Associations

Mutations in MT-CO3 (human COX3 gene) are linked to:

  • Mitochondrial Myopathy: Infantile transient myopathy .

  • Leber Hereditary Optic Neuropathy: Impaired complex IV function .

Production Limitations

  • Membrane Integration: Recombinant COX3 often lacks proper folding in bacterial systems .

  • Post-Translational Modifications: Phosphorylation and lipidation may require eukaryotic hosts .

Therapeutic Potential

  • Gene Therapy: Restoring COX3 expression in mitochondrial disorders .

  • Biomarker Development: ELISA-based detection of COX3 for diagnosing complex IV deficiencies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which customers can use as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ctc-3; coIII; cox-3; MTCE.23; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
ctc-3
Target Protein Sequence
MFHNFHILSLSSYAYNLFFASAGMLSSLVMFFKFGLYELFIFTLFSVLFISFAWGKDIAM EGLSGYHNFFVMDGFKFGVILFVFSEFMFFFCIFCTFFDAALVPVHELGETWSPFGMHLV NPFGVPLLNTIILLSSGVTVTWAHHSLLSNKSCTNSMILTCLLAAYFTGIQLMEYMEASF SIADGVFGSIFYLSTGFHGIHVLCGGLFLAFNFLRLLKNHFNYNHHLGLEFAILYWHFVD VVWLFLFVFVYWWSY
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (cox-3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and the activity of ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. The active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Database Links

KEGG: cel:COX3

STRING: 6239.MTCE.23

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Cytochrome c oxidase subunit 3?

Cytochrome c oxidase subunit III (COX3) is encoded by the MT-CO3 gene in humans, producing a 30 kDa transmembrane protein consisting of 261 amino acids. The protein features a distinctive multi-pass transmembrane structure with seven transmembrane domains located at specific positions (15-35, 42-59, 81-101, 127-147, 159-179, 197-217, and 239-259) . COX3 is positioned within the inner mitochondrial membrane as part of the larger cytochrome c oxidase complex (Complex IV), where it contributes to maintaining the structural integrity of the enzyme complex . The protein belongs to the cytochrome c oxidase subunit 3 family and represents one of the three mitochondrial DNA (mtDNA) encoded subunits of respiratory complex IV, alongside MT-CO1 and MT-CO2 .

What are the optimal expression systems for producing recombinant COX3?

For recombinant production of COX3, researchers must carefully consider the significant challenges posed by its hydrophobic, transmembrane nature. The most effective expression systems employ specialized hosts designed for membrane protein expression, including modified E. coli strains (C41(DE3) or C43(DE3)), insect cell systems (Sf9 or High Five), or mammalian cell lines (HEK293 or CHO). Each expression system requires optimization of codon usage for the MT-CO3 gene, as mitochondrial genetic code differs from nuclear genetic code. Expression vectors should incorporate strong, inducible promoters (T7, CMV) alongside fusion tags (His6, FLAG, or Strep-tag II) positioned at either terminus to facilitate purification without disrupting transmembrane domain folding. Temperature reduction during induction phase (16-25°C) and supplementation with specific lipids have demonstrated significant improvements in functional COX3 yield. For quantitative assessment, successful expression typically achieves 0.5-2 mg of purified recombinant COX3 per liter of culture, with functional validation through cytochrome c oxidase activity assays showing activity in the range of 200-500 μmol cytochrome c oxidized/min/mg protein.

How do COX3 metallochaperones coordinate assembly of the cytochrome c oxidase complex?

The assembly of functional cytochrome c oxidase involves a sophisticated network of metallochaperones that coordinate the incorporation of metal centers into the complex. Research demonstrates that CcO copper chaperones form macromolecular assemblies and cooperate with several twin CX9C proteins to control heme a biosynthesis and coordinate sequential copper transfer to the CuA and CuB sites . This process prevents accumulation of cytotoxic reactive assembly intermediates. The assembly involves distinct modules with progressively overlapping compositions, as revealed through crosslinking and co-immunoprecipitation experiments . Specific chaperones like COX11, SCO1, SCO2, and COX16 show interactions with multiple components, indicating their central role in assembly coordination . For example, COX11 and COX19 consistently co-assemble, while PET191 appears to function before the incorporation of COX17 or COA6 . The redox state of cysteinyl sulfurs in metallochaperones (COX11, SCO1, SCO2) plays a critical role in copper transfer and assembly, with PET191 significantly influencing these redox states . These findings suggest a sequential assembly process where metallochaperone modules progressively incorporate copper and other cofactors into the growing complex.

What methods are most effective for studying COX3 protein-protein interactions in the assembly process?

The most effective methodological approach for studying COX3 protein-protein interactions combines crosslinking, co-immunoprecipitation, and mass spectrometry analysis. The recommended protocol begins with isolation of mitochondria from both wild-type and knockout cell lines for comparative analysis. Treatment with dithiobis(succinimidyl propionate) (DSP) crosslinker captures transient protein-protein interactions, with DMSO-treated samples serving as controls . Membrane proteins are extracted using 0.4% n-dodecyl β-D-maltoside (DDM) under gentle conditions to maintain complex integrity . For tagged proteins, anti-tag (e.g., FLAG) agarose beads enable specific pull-down of protein complexes. Analysis by both immunoblotting and mass spectrometry provides comprehensive interaction mapping, with specific antibodies for known complex components (COX1, COX2, COX11, SCO1, etc.) and unbiased MS identification of novel interactors . For quantitative analysis, data should be compiled into interaction heatmaps reflecting the relative abundance of each protein in the immunoprecipitated complexes, as demonstrated in studies examining COX11 and COX19 knockout effects on complex formation . This integrated approach allows researchers to distinguish between stable and transient interactions, identify assembly intermediates, and construct a dynamic model of the COX3-containing assembly modules.

How can researchers effectively analyze metal content in COX3-containing complexes?

The analysis of metal content in COX3-containing complexes requires careful extraction and sensitive detection methodologies. The recommended protocol utilizes a combination of native complex isolation and inductively coupled plasma mass spectrometry (ICP-MS). Researchers should extract the complexes from purified mitochondria under native conditions without crosslinkers to preserve metal associations . Gentle solubilization with 0.4-0.8% digitonin or n-dodecyl β-D-maltoside maintains complex integrity while liberating membrane-bound assemblies . Following immunoprecipitation of the complexes using antibodies against tagged subunits (e.g., FLAG-tagged COX11), samples should be thoroughly washed with metal-free buffers to remove non-specifically bound metals. For quantitative analysis by ICP-MS, samples and appropriate standards should be acid-digested (typically with nitric acid) prior to analysis . This approach has successfully demonstrated significant copper content in wild-type COX11-containing complexes while revealing the absence of detectable bound copper in complexes associated with mutant COX11 . The typical metal:protein ratio in functional complexes ranges from 0.8-1.0 copper atoms per complex, with detection limits in the ppb range, allowing precise quantification of physiologically relevant metal content.

What are the key pathogenic mechanisms of COX3 variants in mitochondrial disorders?

COX3 variants are associated with several mitochondrial disorders including isolated myopathy, severe encephalomyopathy, Leber hereditary optic neuropathy, mitochondrial complex IV deficiency, and recurrent myoglobinuria . The pathogenic mechanisms involve disruption of COX3's critical role in maintaining cytochrome c oxidase structure and function. At the molecular level, disease-causing variants typically impair one or more of the following processes: (1) proper integration of COX3 into the inner mitochondrial membrane, (2) interaction with other subunits and assembly factors, (3) stability of the fully assembled complex, or (4) proton pumping efficiency during catalysis. Analysis of patient-derived cells shows that pathogenic variants result in assembly defects characterized by accumulation of subcomplexes, particularly those containing COX1 but lacking COX2 . These subcomplexes (labeled S1-S4) resemble intermediates observed in cell lines with mutations affecting COX2 incorporation or metalation . Functional studies demonstrate reduced cytochrome c oxidase activity, decreased heme a+a3 content, and compromised respiratory capacity. The severity of the clinical phenotype typically correlates with the degree of residual enzyme activity, with some variants retaining 15-60% of normal function while others cause complete loss of assembled complex IV and respiratory capacity .

How can CRISPR-Cas9 technology be effectively utilized to study COX3 assembly factors?

CRISPR-Cas9 technology offers powerful approaches for investigating COX3 assembly factors through precise genetic manipulation. The most effective methodological approach begins with careful guide RNA design targeting specific assembly factors (e.g., COX11, COX19) with minimal off-target effects, typically using algorithms like CRISPOR or Benchling . For generating knockout cell lines, researchers should use human cell models like HEK293T that maintain robust mitochondrial function . The protocol involves transfection with both Cas9 and guide RNA constructs, followed by single-cell cloning and comprehensive validation through genomic PCR, Sanger sequencing, and immunoblotting to confirm complete protein ablation . For phenotypic characterization, a multi-parameter assessment approach is recommended, including: (1) immunoblot analysis of steady-state levels of COX subunits (particularly COX1 and COX2), (2) Blue Native-PAGE to identify assembly intermediates, (3) spectrophotometric measurement of cytochrome c oxidase activity, (4) oxygen consumption analysis, and (5) spectral analysis of mitochondrial cytochrome content . This approach has successfully demonstrated differential effects of COX11 and COX19 knockouts, revealing that COX11-deficient cells retain approximately 15% of residual fully assembled cytochrome c oxidase and activity, supporting 60% of respiratory capacity, while COX19-deficient cells show complete loss of assembled complex IV and respiratory function . These findings highlight the utility of CRISPR-Cas9 technology in dissecting the specific roles of assembly factors in the COX3 incorporation pathway.

What role do redox states play in COX3 incorporation into the cytochrome c oxidase complex?

The redox states of cysteinyl sulfurs in metallochaperones play a critical role in coordinating COX3 incorporation into the cytochrome c oxidase complex. Research demonstrates that assembly factors like PET191 significantly influence the redox states of key chaperones including COX11, SCO1, and SCO2 . In the absence of PET191, these chaperones exhibit more reduced cysteinyl sulfurs, impairing their ability to properly coordinate metal transfer and protein assembly . The methodological approach for analyzing these redox states involves thiol-trapping techniques that differentiate between oxidized and reduced cysteines, followed by mass spectrometry analysis to identify specific redox-sensitive residues . Complementation studies with mutant variants (e.g., PET191(C30A, C41A)) show dominant-negative effects on cytochrome c oxidase levels, likely through competition with wild-type proteins for interaction with metallochaperones . When overexpressed, these mutants increase oxidation of COX11, while cells lacking PET191 show increased oxidation of COX11, SCO1, and SCO2 to levels similar to wild-type . These findings suggest a redox-regulated mechanism where the coordinated oxidation and reduction of specific cysteine residues drives the sequential incorporation of metal centers and subunits, including COX3, into the assembling complex. The dynamic redox environment created by these interactions ensures proper timing and specificity in the assembly process, preventing premature or incorrect incorporation that could lead to dysfunctional enzyme complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.