Recombinant Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Evolutionary Conservation and Species Variations

The availability of recombinant COX3 from various species, including the commercially available Tragelaphus scriptus variant, facilitates comparative studies that can illuminate the functional significance of these evolutionary differences . By examining the properties of COX3 from different organisms, researchers can gain insights into the adaptability of the cytochrome c oxidase complex and its role in diverse metabolic contexts.

Expression Systems

The production of recombinant COX3 presents significant technical challenges due to its hydrophobic nature, integral membrane localization, and complex folding requirements. Researchers have employed various expression systems to overcome these challenges, with each system offering distinct advantages and limitations.

Experimental studies have successfully utilized yeast expression systems to produce tagged versions of COX3 for investigational purposes. For instance, researchers have created strains expressing Cox3p with a C-terminal hemagglutinin-protein C tag (Cox3p-HAC) to facilitate detection and purification of the protein and its associated complexes . These engineered constructs provide a means to track the protein throughout its assembly pathway and to identify interacting partners.

Additionally, insect cell expression systems have proven effective for producing components of the cytochrome c oxidase complex. These systems can provide the appropriate cellular machinery for post-translational modifications, including the N-linked glycosylation that is crucial for proper folding and activity of many membrane proteins . The successful expression of tagged versions of COX3 in these systems demonstrates their utility for producing functional recombinant protein for research applications.

Purification Methods

The purification of recombinant COX3 typically employs affinity-based approaches that take advantage of engineered tags introduced into the protein sequence. Researchers working with yeast cytochrome oxidase have successfully used protein C antibody beads to isolate Cox3p-HAC and its associated complexes . This approach enables the selective enrichment of COX3-containing assemblies while maintaining their native-like structural and functional properties.

Following initial purification, techniques such as SDS-PAGE and two-dimensional gel electrophoresis have been employed to characterize the composition and molecular weight of COX3-containing complexes . These analytical methods provide valuable information about the assembly state of the protein and its interactions with other components of the cytochrome oxidase complex.

The purification process must be carefully optimized to preserve the integrity of the protein and its associated complexes, as the hydrophobic nature of COX3 can lead to aggregation or denaturation under inappropriate conditions. The use of mild detergents and stabilizing agents is often necessary to maintain the protein in a soluble and functional state throughout the purification procedure.

Role in Cytochrome c Oxidase Complex

Cytochrome c oxidase functions as the terminal complex of the electron transport chain, facilitating the reduction of molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane. This process is essential for aerobic ATP production in organisms ranging from bacteria to mammals . Within this sophisticated molecular machinery, COX3 serves a crucial structural role.

The enzyme complex contains multiple metal centers that are indispensable for its catalytic function. These include the CuB site in the COX1 subunit, which closely associates with heme a3, and the binuclear CuA site in the COX2 subunit . While COX3 does not directly house these metal centers, it provides essential structural support that maintains the proper orientation and environment for these catalytic sites.

Assembly and Integration

The assembly of cytochrome c oxidase is a tightly regulated process involving numerous steps and specialized assembly factors. Studies in yeast have revealed that Cox3p forms part of a distinct assembly module together with Cox4p, Cox7p, Cox13p, and the accessory factor Rcf1p . This assembly module represents a crucial intermediate in the biogenesis of the complete cytochrome oxidase complex.

Research utilizing radiolabeled Cox3p-HAC has identified several intermediate complexes involved in the assembly pathway. These intermediates, designated as C2, C3, and C4, have approximate molecular weights of 200, 230, and 300 kDa, respectively . The identification of these assembly intermediates provides valuable insights into the stepwise process by which COX3 is incorporated into the functional enzyme complex.

Table 1: COX3-Containing Complexes Identified in Assembly Studies

ComplexApproximate Molecular Weight (kDa)ComponentsReference
C2200Cox3p and associated proteins
C3230Cox3p and associated proteins
C4300Cox3p and associated proteins
COXVaries by speciesComplete cytochrome c oxidase complex
Supercomplexes>700Association of COX with other respiratory complexes

The identification of these discrete assembly intermediates highlights the sequential and coordinated nature of cytochrome c oxidase biogenesis. Each step in this process must occur correctly to ensure the formation of a fully functional enzyme complex capable of supporting mitochondrial respiration.

Interaction with Other Subunits

COX3 engages in multiple protein-protein interactions within the cytochrome c oxidase complex that are essential for the stability and function of the enzyme. Two-dimensional gel electrophoresis studies have demonstrated that newly translated Cox3p associates with other cytochrome oxidase subunits, including Cox1p and Cox2p, to form supercomplexes . These higher-order assemblies represent the fully functional form of the enzyme in its native membrane environment.

Research has demonstrated that deficiencies in other components of the complex can significantly impact the assembly and stability of COX3. For instance, studies with a cox7-null mutant in yeast revealed the absence of fully assembled cytochrome oxidase and respiratory supercomplexes, although some radiolabeled Cox3p could still be detected in particular intermediate assemblies . This observation underscores the interdependence of the various subunits in the proper assembly and function of the complete enzyme complex.

Interestingly, among the three mitochondrially encoded subunits of cytochrome c oxidase, Cox3p has been observed to be the most highly labeled in supercomplexes in some studies . This finding suggests a particularly important role for COX3 in the formation and stability of these respiratory chain supercomplexes, which optimize the efficiency of electron transfer and energy production in mitochondria.

Metal Centers in Cytochrome c Oxidase

Cytochrome c oxidase contains multiple metal centers that are critical for its enzymatic function. As a heme aa3-copper oxygen reductase, the complex relies on these metal cofactors to facilitate the electron transfer reactions that drive oxygen reduction and proton pumping . The precise arrangement and coordination of these metal centers are essential for the catalytic activity of the enzyme.

The enzyme contains two copper sites located in its catalytic core subunits: the CuB site in the COX1 subunit, which forms a close association with heme a3, and the binuclear CuA site in the COX2 subunit . These copper centers, along with the heme groups, create an electron transfer pathway that allows the complex to reduce molecular oxygen to water while simultaneously pumping protons across the inner mitochondrial membrane.

While COX3 itself does not directly contain metal centers, its structural role within the complex may influence the local environment of these catalytic sites. By maintaining the appropriate three-dimensional architecture of the enzyme, COX3 helps ensure that the metal centers are positioned optimally for efficient electron transfer and catalysis.

Biogenesis of Metal Centers

The biogenesis of metal centers in cytochrome c oxidase represents a highly coordinated process that must be precisely regulated to ensure proper enzyme assembly and function. Research has revealed that in human cells, copper chaperones form macromolecular assemblies and collaborate with several twin CX9C proteins to control heme a biosynthesis and coordinate the sequential transfer of copper to the CuA and CuB sites .

This sophisticated coordination mechanism serves a crucial regulatory function in the biogenesis of enzymatic assemblies containing multiple catalytic metal redox centers. Importantly, this regulation prevents the accumulation of cytotoxic reactive assembly intermediates that could damage cellular components . The sequential and controlled incorporation of metal cofactors ensures that potentially reactive sites are properly neutralized until the complete enzyme complex is assembled.

Although COX3 does not directly participate in metal binding, its proper assembly and integration into the complex are likely essential for the successful coordination of metal center biogenesis. The structural framework provided by COX3 may create the appropriate environment for the metallochaperones to deliver their metal cargoes to the correct sites within the complex, thereby facilitating the formation of a fully functional enzyme.

Assembly and Function Analysis

Recombinant COX3 has proven invaluable for investigating the assembly pathway and functional properties of cytochrome c oxidase. By utilizing tagged versions of the protein, researchers can monitor its incorporation into assembly intermediates and the mature enzyme complex with high specificity and sensitivity.

Radio-labeling techniques combined with immunoprecipitation have allowed for the visualization of newly synthesized Cox3p and its integration into larger complexes . These approaches have yielded important insights into the sequential steps of cytochrome c oxidase assembly and the specific roles of individual subunits in this process. The identification of discrete assembly intermediates containing COX3 has enhanced our understanding of the regulated biogenesis of this complex respiratory enzyme.

Therapeutic Potential

Research on recombinant COX3 carries significant implications for understanding and potentially treating mitochondrial disorders associated with cytochrome c oxidase deficiency. These disorders can arise from mutations in the genes encoding COX subunits or assembly factors, leading to impaired enzyme activity and compromised cellular respiration.

By elucidating the molecular details of COX3 structure, assembly, and function, researchers may identify novel therapeutic targets or strategies for addressing these devastating mitochondrial diseases. The coordinated biogenesis of metal centers in cytochrome c oxidase, as described in the research literature , represents one potential avenue for therapeutic intervention aimed at improving enzyme assembly and function in patients with specific defects.

Additionally, recombinant COX3 could potentially serve as a component in protein replacement therapies or as a template for designing small molecules that might stabilize defective enzyme complexes. The availability of well-characterized recombinant protein facilitates the screening of potential therapeutic agents and the development of targeted approaches to mitochondrial respiratory chain disorders.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
COX3; COXIII; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Cyanidium caldarium (Red alga)
Target Names
COX3
Target Protein Sequence
MMSLIVKDLQRYPFHLVDPSPWPFVASFSALIILLGGVLYFHTYQGSLVILFFGIFFLLL IIFVWWRDVVRESTFEGNHTTMVQLGMRYGIMLFIFSEVILFIAFFWAFFHNSLIPALET GVVWPPKGIQFFSPWDIPFLNTIILLLSGCAVTWSHNCIISGFRRQAIFSLILTIGLALI FTIFQIYEYAIASFHLSDGAYGSTFFMITGLHGFHVIVGTFFLFVCMFRLVQYHFTMQHH YGFEAATWYWHFVDVVWLFLFVSIYWWGSF
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a crucial component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain consists of three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes cooperate to transfer electrons originating from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the respiratory chain component that catalyzes oxygen reduction to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)), reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.