Recombinant Cytochrome c oxidase subunit 3 (MT-CO3)

Shipped with Ice Packs
In Stock

Description

Production Systems for Recombinant MT-CO3

Recombinant MT-CO3 is synthesized using heterologous expression systems to study its role in mitochondrial disorders and energy metabolism .

Host SystemYieldAdvantages
E. coliHighCost-effective, rapid production; lacks post-translational modifications
YeastModerateEukaryotic folding; partial post-translational modifications
Insect CellsLowNear-native modifications; suitable for functional studies
Mammalian CellsLowFull native structure; used for therapeutic research

Functional and Mechanistic Insights

  • Electron Transport Role: MT-CO3 forms part of the cytochrome c oxidase complex, catalyzing oxygen reduction to water while pumping protons to establish the mitochondrial electrochemical gradient . The reaction is:

    4cytochrome c2++4H++O24cytochrome c3++2H2O4 \, \text{cytochrome } c^{2+} + 4 \, \text{H}^+ + \text{O}_2 \rightarrow 4 \, \text{cytochrome } c^{3+} + 2 \, \text{H}_2\text{O}
  • Metal Homeostasis: Downregulation of MT-CO3 disrupts mitochondrial copper, zinc, and iron levels, impairing oxidative phosphorylation .

Research Applications

Recombinant MT-CO3 is critical for studying mitochondrial diseases and developing diagnostics:

Key ELISA Kits for MT-CO3 Quantification

KitSpeciesSensitivityDetection RangeApplicationsSource
Mouse MTCO3 ELISA KitMouse39.5 pg/mL78–5,000 pg/mLMitochondrial dysfunction studies Assay Genie
Human COX3 ELISA KitHuman<0.1 ng/mL0.156–10 ng/mLBiomarker analysis in neurodegeneration Abbexa
Mouse COX3 ELISA KitMouse0.119 ng/mL0.312–20 ng/mLEnergy metabolism research Assay Genie

Clinical and Research Findings

  • Disease Associations:

    • Mutations in MT-CO3 cause Leber hereditary optic neuropathy (LHON) and mitochondrial complex IV deficiency, linked to symptoms like muscle weakness and encephalopathy .

    • Altered MT-CO3 expression correlates with zinc and copper dysregulation, exacerbating oxidative stress in neurodegenerative models .

  • Therapeutic Potential: Recombinant MT-CO3 aids in restoring electron transport chain activity in cell cultures, offering pathways for treating mitochondrial myopathies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-CO3; COIII; COXIII; MTCO3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Theileria parva (East coast fever infection agent)
Target Names
Target Protein Sequence
MRNSAQSYLKYINIINIFETLYLFYSTGLDTLEYIDSTYKNFIIMYVNQYLLYGTTLKYL SVGEFFMNSLTIFINSIREIMTSTTMVMYAIFGMFIFSEILVFSTFIWGYFHLRLSNPIL LAELNVEAYLQISDVLNTGSILVSIILHRVQESANFETDFFMEQLLLIGFIFLSLQNDEY SLILSYVNNYWMTLYFFILTGLHSLHVCAGGIFVLIQSYFYEGDGSQRDEEFNAGVYWHF VEMIWIALTMLLFLA
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (MT-CO3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the respiratory chain component responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of MT-CO3 in the respiratory chain?

MT-CO3 (Cytochrome c oxidase subunit 3) is a critical component of the respiratory chain that catalyzes the reduction of oxygen to water. As part of cytochrome c oxidase (Complex IV), it contributes to the electron transport process where electrons originating from reduced cytochrome c in the intermembrane space are transferred through the enzyme complex to molecular oxygen, ultimately creating an electrochemical gradient across the inner membrane that drives ATP synthesis. While MT-CO3 lacks an active center, it is essential for maintaining the structural integrity and preserving the catalytic activity of the cytochrome c oxidase complex .

The electron transfer process through cytochrome c oxidase involves multiple steps:

  • Electrons transfer from reduced cytochrome c to the dinuclear copper A center (CU(A)) in subunit 2

  • From there to heme A in subunit 1

  • Finally to the binuclear center (BNC) formed by heme A3 and copper B (CU(B))

  • This BNC reduces molecular oxygen to water using 4 electrons from cytochrome c and 4 protons from the mitochondrial matrix .

How does recombinant MT-CO3 differ from natively expressed protein?

Recombinant MT-CO3 production presents unique challenges compared to other recombinant proteins due to its hydrophobic nature and mitochondrial origin. When comparing recombinant with native MT-CO3, researchers should consider several key differences:

  • Post-translational modifications: Native MT-CO3 undergoes specific mitochondrial modifications that may be absent or different in recombinant systems

  • Protein folding: The proper folding of recombinant MT-CO3 may require specialized chaperones normally present in the mitochondrial environment

  • Stability considerations: Without its normal protein-protein interactions with other cytochrome c oxidase subunits, recombinant MT-CO3 typically shows decreased stability

  • Functional assessment: Isolated recombinant MT-CO3 lacks the functional context of the complete cytochrome c oxidase complex

When designing experiments, researchers should carefully evaluate whether these differences impact the specific research questions being addressed .

What are the optimal expression systems for recombinant MT-CO3 production?

The production of functional recombinant MT-CO3 requires careful consideration of expression systems due to its hydrophobic nature and role as a mitochondrial membrane protein. Methodological approaches should include:

  • Bacterial expression systems: E. coli systems with specialized vectors containing solubility tags (such as MBP or SUMO) can improve expression, though protein folding remains challenging

  • Yeast expression systems: S. cerevisiae or P. pastoris often provide better folding environments for mitochondrial proteins

  • Mammalian cell expression: HEK293 or CHO cells offer more native-like post-translational modifications

  • Cell-free systems: These can be effective for difficult membrane proteins like MT-CO3 by providing controlled detergent environments

For optimal results, expression constructs should include:

  • Codon optimization for the selected expression system

  • Appropriate solubility and purification tags

  • Signal sequences directing the protein to membranes (when applicable)

  • Inducible promoters for controlling expression levels

Purification strategies should employ gentle detergents like DDM or LMNG that maintain protein structure while extracting MT-CO3 from membranes .

What are validated methods for assessing MT-CO3 function in experimental models?

Assessing MT-CO3 function requires methodologies that evaluate both its individual properties and its contribution to cytochrome c oxidase activity. Validated approaches include:

For cell culture models, researchers should consider COX/CS (cytochrome c oxidase/citrate synthase) activity ratios to normalize for mitochondrial content differences. When using isolated mitochondria, respiratory control ratios provide valuable information about coupling efficiency .

How do MT-CO3 mutations contribute to mitochondrial disease pathology?

MT-CO3 mutations can significantly impact mitochondrial function through several mechanistic pathways. The pathophysiology typically involves:

For example, the m.9553G>A variant changes a highly conserved tryptophan to a stop codon (p.Trp116*), resulting in a truncated MT-CO3 protein. In the reported case, this variant caused MELAS syndrome with typical hallmarks including:

  • Ragged-red fibers in muscle pathology

  • COX-deficient muscle fibers

  • Reduced levels of multiple cytochrome c oxidase subunits (COX1, COX2, COX3, COX4)

  • Significantly decreased COX respiratory activity (58.84% reduction compared to controls) .

What techniques are most reliable for detecting MT-CO3 mutations in clinical samples?

The detection of MT-CO3 mutations presents unique challenges due to heteroplasmy (the coexistence of wild-type and mutant mtDNA in varying proportions). A comprehensive mutation detection strategy should include:

  • Next-generation sequencing (NGS): Provides high sensitivity for detecting low-level heteroplasmy and can simultaneously screen the entire mitochondrial genome

  • PCR-RFLP analysis: Cost-effective method for known mutations that alter restriction sites

  • Pyrosequencing: Offers precise quantification of heteroplasmy levels

  • Digital droplet PCR: Highly sensitive for detecting and quantifying known mutations

  • Single-fiber PCR analysis: Enables correlation of mutation load with COX deficiency at the individual muscle fiber level

When analyzing clinical samples, researchers should consider:

Tissue TypeAdvantagesLimitationsTypical Heteroplasmy Detection Threshold
MuscleHigh mtDNA content, clinically relevantInvasive sampling1-2%
BloodEasy samplingOften low mutation load3-5%
Urine sedimentNon-invasive, good for maternal lineage studiesVariable cell content2-3%
Oral epithelial cellsNon-invasive, simple collectionVariable mutation load2-3%

As demonstrated in the case report of the m.9553G>A variant, mutation load varied significantly across tissues: 13% in oral epithelial cells, 89% in muscle samples, and undetectable in peripheral blood lymphocytes. This heterogeneity highlights the importance of appropriate tissue selection for diagnostic testing .

How can researchers effectively model MT-CO3 mutations in experimental systems?

Creating accurate experimental models for MT-CO3 mutations requires sophisticated approaches that recapitulate the complex genetics of mitochondrial DNA. Methodological strategies include:

  • Cybrid cell models: Depleting cells of endogenous mtDNA and repopulating with patient-derived mitochondria containing MT-CO3 mutations

  • CRISPR-based mitochondrial editing: Though challenging, newer techniques allow site-specific editing of mtDNA

  • Bacterial complementation systems: Expressing MT-CO3 variants in bacterial cytochrome c oxidase to assess functional impacts

  • Induced pluripotent stem cells (iPSCs): Patient-derived iPSCs maintain the original heteroplasmy and can be differentiated into disease-relevant cell types

  • Organoid systems: Provide three-dimensional tissue context for evaluating MT-CO3 mutation effects

When designing models, researchers should consider:

  • Controlling heteroplasmy levels to create physiologically relevant conditions

  • Including appropriate wild-type controls

  • Implementing tissue-specific differentiation protocols when using stem cell models

  • Validating models through functional respiratory measurements and proteomics

For quantitative assessment of mitochondrial dysfunction, researchers should combine multiple readouts including oxygen consumption rates, ATP production, membrane potential measurements, and reactive oxygen species production .

What are the current challenges in correlating MT-CO3 expression with protein abundance?

Understanding the relationship between MT-CO3 gene expression and protein abundance presents several analytical challenges. Current research indicates:

  • Tissue-specific correlation patterns: The correlation between mtDNA copy number, mtRNA levels, and protein abundance varies significantly between tissues and disease states

  • Post-transcriptional regulation: Mitochondrial RNA processing, stability, and translation efficiency can substantially impact the relationship between transcript and protein levels

  • Technical limitations: Different quantification methodologies (RNA-seq, RT-qPCR, proteomics) have varying sensitivity and dynamic ranges

In cancer studies, for example, TCGA consortium data showed strong correlation between MT-CO2 mRNA and protein levels (Spearman correlation 0.38, p-value <10^-14), but a weaker correlation with mtDNA copy number (Spearman correlation 0.18, p-value 0.003). This suggests that post-transcriptional mechanisms significantly influence mitochondrial protein abundance .

For reliable correlation analysis, researchers should:

  • Use multiple methodological approaches (RNA-seq, qPCR, western blotting, mass spectrometry)

  • Account for technical variables in sample preparation

  • Consider cell/tissue heterogeneity in the samples

  • Employ appropriate statistical methods for correlation analysis

How do changes in MT-CO3 affect the assembly and stability of cytochrome c oxidase?

The assembly and stability of cytochrome c oxidase depend critically on MT-CO3 through several mechanisms:

  • Sequential assembly pathway: MT-CO3 incorporation represents a specific step in the coordinated assembly of the cytochrome c oxidase complex

  • Structural stabilization: Though lacking catalytic centers, MT-CO3 provides essential structural support that maintains the proper conformation of the complex

  • Interaction with assembly factors: MT-CO3 engages with specific assembly factors and chaperones during the biogenesis of cytochrome c oxidase

Experimental evidence from pathogenic mutations illustrates these effects. Analysis of the m.9553G>A variant showed that MT-CO3 disruption led to decreased levels of multiple cytochrome c oxidase subunits (COX1, COX2, COX3, COX4, and UQCRC2), suggesting that MT-CO3 dysfunction affects the stability of the entire complex .

For studying assembly dynamics, researchers should employ:

  • Pulse-chase experiments with radiolabeled amino acids

  • Blue native PAGE combined with second-dimension SDS-PAGE

  • Complexome profiling using mass spectrometry

  • Cryo-EM structural analysis of assembly intermediates

What bioinformatic approaches are most effective for analyzing MT-CO3 sequence conservation and variation?

Bioinformatic analysis of MT-CO3 requires specialized approaches due to its mitochondrial origin and high conservation. Effective analytical strategies include:

  • Multiple sequence alignment: Using algorithms optimized for highly conserved proteins (MUSCLE, T-Coffee) to identify functionally critical residues

  • Phylogenetic analysis: Constructing phylogenetic trees to understand evolutionary relationships and conservation patterns

  • Variation databases: Utilizing specialized mitochondrial databases (MITOMAP, MitoNUMTs) to distinguish genuine mtDNA variants from nuclear pseudogenes

  • Structural prediction: Applying membrane protein-specific modeling tools to predict the impact of variants on protein structure

When analyzing RNA-seq data for MT-CO3 expression, researchers should be aware of potential confounding factors:

  • Contamination from nuclear mitochondrial DNA segments (NUMTs)

  • Multi-mapping reads that align to both mtDNA and nuclear genome

  • Biases in RNA isolation and library preparation methods

Comparison of computational approaches such as RSEM and featureCounts shows that for most studies, both methods produce concordant results for MT-CO3 expression analysis, supporting the hypothesis that NUMT expression is negligibly low and does not significantly confound estimates of true mtDNA expression .

What are the recommended protocols for distinguishing MT-CO3 from nuclear-encoded mitochondrial pseudogenes?

Distinguishing authentic MT-CO3 from nuclear mitochondrial DNA segments (NUMTs) requires specific methodological approaches. Recommended protocols include:

  • Mitochondrial enrichment: Physical separation of mitochondria before DNA extraction using differential centrifugation or antibody-based methods

  • Long-range PCR: Amplifying large mtDNA fragments (>5kb) that exceed the typical size of NUMT insertions

  • RNA-based approaches: Analyzing polyadenylated mitochondrial transcripts, which differ from NUMT-derived transcripts

  • Computational filters: Implementing stringent mapping quality thresholds and specific alignment parameters

For RNA-seq analysis, comparing expression estimates from different computational approaches can help validate results. Studies have shown excellent agreement between RSEM (which handles multi-mapping reads using expectation-maximization) and featureCounts (which discards multi-mapping reads) for mtDNA-encoded genes, further confirming that NUMT expression is typically negligible .

For heteroplasmy analysis, researchers should implement:

  • Amplicon deep sequencing with unique molecular identifiers (UMIs)

  • Strand-specific library preparation to distinguish strand-specific transcription patterns

  • Appropriate statistical models for detecting low-frequency variants

What emerging technologies are showing promise for targeted MT-CO3 manipulation?

Several cutting-edge technologies are advancing our ability to manipulate MT-CO3 and other mitochondrial genes with increasing precision:

  • MitoTALENs and mitochondrially-targeted ZFNs: Engineered nucleases that can target and cleave specific mtDNA sequences

  • Base editors: Modified CRISPR systems capable of making precise C→T or A→G substitutions without double-strand breaks

  • RNA-based approaches: Mitochondrially-targeted RNA import systems for transient manipulation of MT-CO3 expression

  • Allotopic expression: Nuclear expression of recoded MT-CO3 with mitochondrial targeting sequences

  • Nanobody technology: Developing antibody-based tools for MT-CO3 visualization and manipulation in living cells

These technologies offer promising approaches for:

  • Creating precise disease models with specific MT-CO3 mutations

  • Developing potential therapeutic strategies for MT-CO3-related diseases

  • Probing structure-function relationships with unprecedented precision

  • Understanding the tissue-specific effects of MT-CO3 variants

As these technologies continue to develop, researchers should consider combining multiple approaches to overcome the current limitations in mitochondrial genome engineering .

How can researchers integrate MT-CO3 data with broader mitochondrial function studies?

Integrating MT-CO3 research within the broader context of mitochondrial biology requires multidisciplinary approaches:

For effective data integration, researchers should:

  • Standardize experimental conditions across different assay types

  • Develop consistent metadata annotation practices

  • Employ statistical methods designed for integrating heterogeneous data types

  • Consider temporal dynamics in mitochondrial responses

Cancer research demonstrates the value of integrated approaches, revealing that correlations between mtDNA copy number and mtRNA are not necessarily homogeneous between tumor and normal samples from the same tissue. This suggests that compensation for mitochondrial dysfunction may occur through different mechanisms in different contexts .

What are the current consensus best practices for MT-CO3 research?

Based on current evidence and methodological developments, researchers investigating MT-CO3 should consider these best practices:

  • Experimental design considerations:

    • Include appropriate controls for heteroplasmy levels

    • Validate findings across multiple cell types or tissues

    • Use complementary approaches to confirm key results

    • Consider the broader context of cytochrome c oxidase function

  • Technical recommendations:

    • Employ rigorous quality control in mtDNA sequencing and expression analysis

    • Validate antibodies specifically for MT-CO3 detection

    • Standardize functional assays to enable cross-study comparisons

    • Document heteroplasmy levels in experimental models

  • Data reporting standards:

    • Report detailed methodological information including heteroplasmy quantification methods

    • Provide raw data in standardized formats

    • Use consistent nomenclature for MT-CO3 variants following HGVS guidelines

    • Specify the exact nuclear and mitochondrial genome references used

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.