Recombinant Cytochrome c1 (petC)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Cytochrome c1 (petC)

Recombinant Cytochrome c1 (petC) refers to a form of the Cytochrome c1 protein that has been produced using recombinant DNA technology . Cytochrome c1 is a subunit of the cytochrome b-c1 complex, also known as ubiquinol-cytochrome c reductase, which is an essential component of the respiratory chain in mitochondria and some bacteria .

Production of Recombinant Cytochrome c1

Recombinant Cytochrome c1 is typically produced by cloning the petC gene, which encodes for Cytochrome c1, into a suitable expression vector . This vector is then introduced into a host organism such as E. coli, yeast, baculovirus, or mammalian cells, which then produces the Cytochrome c1 protein . The recombinant protein can then be isolated and purified for use in various applications .

Function and Importance

Cytochrome c1 is a critical component of the respiratory chain, where it mediates electron transfer between cytochrome b and cytochrome c . This process is essential for generating a proton gradient across the mitochondrial membrane, which drives ATP synthesis . Research has shown that Cytochrome c1 interacts with other proteins, such as CcmI, a chaperone protein that assists in the maturation of c-type cytochromes .

Applications in Research

Recombinant Cytochrome c1 is used in various research applications, including:

  • Structural and functional studies Recombinant Cytochrome c1 can be used to investigate the protein's structure, function, and interactions with other molecules .

  • Drug discovery Cytochrome c1 is a potential drug target, and recombinant Cytochrome c1 can be used in screening assays to identify compounds that affect its activity .

  • ** изучение метаболизма лекарств** Recombinant Cytochrome c1 may be used to develop systems for the investigation of drug metabolism .

  • Antibody development: Recombinant forms can assist in the development of antibodies that target Cytochrome c for research and diagnostic purposes .

Examples of Research Findings

  • Studies in C. elegans Research has utilized recombinant C. elegans Cytochrome c proteins (CYC-2.1 and CYC-2.2) to understand their interactions with cardiolipin-containing liposomes, revealing structural and functional similarities to mammalian Cytochrome c .

  • Maturation Studies Recombinant Cytochrome c1 has been used to study the maturation process of c-type cytochromes, including the role of chaperone proteins like CcmI .

  • Mutational Analysis Mutational studies involving recombinant Cytochrome c1 have provided insights into the structure-function relationship of this protein .

Expression Systems

Expression SystemHost OrganismApplications
E. coliBacteriaHigh yield, cost-effective, suitable for many applications .
YeastSaccharomyces cerevisiae, Pichia pastorisPost-translational modifications, suitable for eukaryotic proteins .
BaculovirusInsect cellsHigh expression levels, post-translational modifications, suitable for complex proteins .
Mammalian cellsHEK 293, CHO cellsCorrect folding and post-translational modifications, suitable for proteins requiring specific modifications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customer use.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
petC; Cytochrome c1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-450
Protein Length
Full Length of Mature Protein
Species
Paracoccus denitrificans
Target Names
petC
Target Protein Sequence
AVAQDASTAPGTTAPAGSSYHTNEAAPAAADTAPAAEAADEPAAEEAEAGEAEVTEEPAA TETPAEEPAADEPAATEEPDAEAEPAAEEAQATTEEAPAEEPAAEEPAAEEPAEEPAADA PAEEAAAEEAPAEPEAAAEEPAAEEPEATEEEAPAEEAAAEEAPAEEVVEDEAAADHGDA AAQEAGDSHAAAHIEDISFSFEGPFGKFDQHQLQRGLQVYTEVCSACHGLRYVPLRTLAD EGGPQLPEDQVRAYAANFDITDPETEEDRPRVPTDHFPTVSGEGMGPDLSLMAKARAGFH GPYGTGLSQLFNGIGGPEYIHAVLTGYDGEEKEEAGAVLYHNAAFAGNWIQMAAPLSDDQ VTYEDGTPATVDQMATDVAAFLMWTAEPKMMDRKQVGFVSVIFLIVLAALLYLTNKKLWQ PIKHPRKPE
Uniprot No.

Target Background

Function

Recombinant Cytochrome c1 (petC) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex). This complex is part of the respiratory electron transport chain, generating an electrochemical potential essential for ATP synthesis. Within this complex, Cytochrome c1 functions as an electron donor to cytochrome c.

Subcellular Location
Cell membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.