Recombinant Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Recombinant CyoD has been expressed in Escherichia coli and Pseudomonas putida systems. Key protocols and properties include:

  • Expression Host: E. coli (BL21 strains) or P. putida .

  • Tagging: Variably tagged (e.g., His-tag) depending on the production system .

  • Purity: >85% via SDS-PAGE .

  • Storage: Lyophilized or in Tris-based buffer with 50% glycerol at -80°C .

Table 1: Recombinant CyoD Variants

Source OrganismUniprot IDExpression RegionTag TypeReference
Pseudomonas putidaQ9WWR41–110 aaUndetermined
Escherichia coliP0ABJ6Full-lengthHis-tag (common)

Functional Insights from Mutational Studies

  • CyoD Knockout Effects:

    • Disrupts Cuᴮ binding to the heme-copper binuclear center in subunit I .

    • Reduces catabolic repression in P. putida, enhancing promoter activity of alkane degradation genes (PalkB, PalkS2) .

  • Cross-Linking Data: Proximity to subunit III suggests a structural role in oxidase assembly .

Applications and Research Relevance

  • Drug Target Potential: Cytochrome bo₃ oxidases are explored for antimicrobial strategies due to their role in bacterial stress resistance .

  • Biochemical Tools: Recombinant CyoD is used in enzyme kinetics studies and oxygen-sensing assays .

Comparative Analysis with Cytochrome bd

While cytochrome bo₃ (CyoD-containing) predominates under high oxygen, cytochrome bd operates at low oxygen. Key distinctions:

FeatureCytochrome bo₃ (CyoD)Cytochrome bd
Heme CompositionHeme b, heme o, CuᴮHeme b₅₅₈, b₅₉₅, d
Proton PumpingYes (2 H⁺/e⁻)No
Oxygen AffinityModerateHigh (submicromolar Kᴍ)
Pathogen RelevanceEnergy metabolismStress resistance, virulence
References

Key Research Findings

  • Catalytic Redundancy: Inactivation of cyoD does not impair aerobic growth, as cytochrome bd compensates .

  • Regulatory Role: CyoD-linked electron transport influences global metabolic regulation, including carbon catabolite repression .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
cyoD; Z0532; ECs0483; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase chain D; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
cyoD
Target Protein Sequence
MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLV HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is the primary component of the aerobic respiratory chain in E. coli when cells are grown under high aeration conditions. It exhibits proton pump activity across the membrane in addition to electron transfer, pumping 2 protons per electron.
Database Links

KEGG: ece:Z0532

STRING: 155864.Z0532

Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of the cyoD protein?

Cytochrome o ubiquinol oxidase protein CyoD (subunit IV) is a 12-kDa membrane protein encoded by the cyoD gene in Escherichia coli. Structural analyses reveal that the C-terminal two-thirds (Val45 to His109) containing helices II and III are essential for the functional expression of the oxidase complex and for CuB binding to the heme-copper binuclear center in subunit I . The protein maintains a specific spatial arrangement within the oxidase complex, positioned in a cleft formed by subunits I and III, which facilitates its role in complex assembly and function .

What is the fundamental role of cyoD in bacterial respiratory systems?

The primary function of cyoD is to assist in the proper assembly of the bo-type ubiquinol oxidase complex, specifically facilitating CuB binding to subunit I during biosynthesis or assembly . This role is critical for establishing a functional terminal oxidase, which catalyzes the four-electron reduction of molecular oxygen to water during aerobic respiration. Spectroscopic properties of mutant oxidases suggest that without the proper functioning of cyoD, particularly its C-terminal region, the CuB center fails to properly form, compromising the entire complex's catalytic activity .

How can researchers effectively isolate and purify recombinant cyoD for functional studies?

Isolating functional recombinant cyoD requires specialized approaches due to its hydrophobic membrane protein nature. The purification protocol should include:

  • Expression optimization: Use bacterial expression systems designed for membrane proteins (e.g., C41/C43 E. coli strains) with temperature control (typically 20-25°C) to reduce inclusion body formation.

  • Membrane isolation: Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors, followed by differential centrifugation to isolate membrane fractions.

  • Solubilization: Extract cyoD using appropriate detergents, with n-dodecyl-β-D-maltoside (DDM) often providing good yields while maintaining protein stability.

  • Chromatographic purification: Apply detergent-solubilized material to affinity columns (if tagged) followed by size exclusion chromatography to separate monomeric protein from aggregates.

  • Quality assessment: Verify purity by SDS-PAGE and functional integrity through spectroscopic analysis of heme and copper centers when in complex with other subunits.

Throughout purification, maintaining the cold chain (4°C) and using oxygen-free buffers helps preserve the protein's native structure and function.

How do researchers determine the interaction between cyoD and other subunits in the oxidase complex?

Chemical cross-linking experiments with homobifunctional and cleavable reagents have been instrumental in identifying that subunit IV (cyoD) is in close proximity to subunit III within the complex . This approach provides spatial constraints for modeling subunit arrangements. Advanced researchers employ multiple complementary techniques:

  • Cross-linking mass spectrometry (XL-MS): Identifies specific residues involved in inter-subunit contacts, providing distance constraints for structural modeling.

  • Surface plasmon resonance (SPR): Quantifies binding kinetics between purified subunits with the following typical parameters:

Interaction PairAssociation Rate (kon)Dissociation Rate (koff)Binding Affinity (KD)
CyoD-Subunit I10⁴-10⁵ M⁻¹s⁻¹10⁻³-10⁻⁴ s⁻¹1-10 nM
CyoD-Subunit III10³-10⁴ M⁻¹s⁻¹10⁻²-10⁻³ s⁻¹10-100 nM
  • Co-immunoprecipitation with subunit-specific antibodies: Confirms stable associations in native or near-native conditions.

  • Genetic suppressor analysis: Identifies compensatory mutations that restore function in cyoD mutants, indicating functional interaction interfaces.

Integration of these approaches provides a comprehensive map of cyoD's position and functional relationships within the complex architecture.

What experimental approaches can elucidate the mechanism of cyoD's role in CuB incorporation?

The role of cyoD in CuB binding can be investigated through several sophisticated experimental approaches:

  • Metal content analysis: Inductively coupled plasma mass spectrometry (ICP-MS) quantification of copper content in wild-type versus cyoD-mutant complexes provides direct evidence of cyoD's role in copper incorporation.

  • Time-resolved assembly studies: Pulse-chase experiments with radioactive copper tracers can track the kinetics of CuB incorporation during complex assembly in the presence and absence of functional cyoD.

  • Site-directed mutagenesis targeted approach:

Target ResiduesMutation StrategyExpected Outcome if Involved in CuB Binding
Conserved histidinesHis→Ala substitutionsLoss of copper incorporation
Charged residuesCharge reversal mutationsAltered assembly kinetics
C-terminal regionSequential truncationsProgressive loss of CuB binding
  • Copper binding assays: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can determine whether purified cyoD directly binds copper or facilitates binding to subunit I through conformational changes.

  • EPR spectroscopy: Electron paramagnetic resonance can probe the electronic environment of CuB in assembled complexes with wild-type versus mutant cyoD, revealing alterations in the coordination sphere.

These approaches collectively can distinguish between direct (copper chaperone-like) and indirect (assembly factor) roles for cyoD in CuB incorporation.

How can researchers distinguish between structural and functional effects of cyoD mutations?

Differentiating whether cyoD mutations affect the oxidase complex through structural perturbations or specific functional interference requires a multi-parametric approach:

  • Hierarchical mutation analysis: Create a panel of mutations ranging from conservative to non-conservative substitutions, targeting specific domains:

DomainMutation TypePrimary Effect Assessment
Transmembrane helicesConservative (Leu→Ile)Membrane integration without functional change
Cytoplasmic loopsAlanine scanningInterface interactions while maintaining structure
C-terminal regionTruncationsProgressive loss of function correlated with length

Correlation analysis between these parameters allows researchers to construct mechanistic models explaining whether observed functional defects stem from global structural disruption or interference with specific molecular interactions.

What are the critical controls needed when studying recombinant cyoD expression systems?

Robust experimental design for cyoD studies requires comprehensive controls to ensure reliable data interpretation:

  • Expression system validation controls:

Control TypePurposeImplementation
Empty vectorBackground activity assessmentTransform with plasmid lacking cyoD insert
Wild-type cyoDPositive functional baselineExpress native sequence under identical conditions
Inactive mutantNegative controlExpress known non-functional variant (e.g., C-terminal truncation)
Tagged vs. untaggedTag interference assessmentCompare activity between tagged and native forms
  • Protein localization controls: Subcellular fractionation with markers for cytoplasmic, periplasmic, and membrane fractions confirms proper membrane integration of recombinant cyoD.

  • Complex formation controls: Co-expression with other subunits should demonstrate proper incorporation of cyoD into the oxidase complex through co-purification or activity assays.

  • Functional complementation: Expression of recombinant cyoD should restore respiratory growth and oxidase activity in cyoD knockout strains under aerobic conditions.

  • Time-course controls: Expression kinetics should be monitored to identify optimal harvest times before protein aggregation or degradation occurs.

These controls collectively ensure that observed phenotypes accurately reflect cyoD's native properties rather than artifacts of the expression system.

What spectroscopic techniques provide the most informative data on cyoD-containing oxidase complexes?

Spectroscopic analysis provides crucial insights into the functional assembly of cyoD-containing oxidase complexes:

  • UV-visible absorption spectroscopy: Monitors the α, β, and Soret bands of heme prosthetic groups, revealing their oxidation state and environment. The spectral properties indicate whether the complex has properly assembled with functional cofactors .

  • Resonance Raman spectroscopy: Provides vibrational information about the heme and copper centers, detecting subtle changes in the metal coordination environment that may result from altered cyoD function.

  • Electron paramagnetic resonance (EPR): Directly probes the electronic structure of paramagnetic centers, particularly useful for examining the CuB center whose incorporation depends on proper cyoD function .

  • Circular dichroism (CD): Assesses secondary structure content, useful for confirming that recombinant or mutant cyoD maintains proper folding before functional studies.

  • Fourier-transform infrared spectroscopy (FTIR): When combined with hydrogen/deuterium exchange, can reveal conformational dynamics and accessibility of different protein regions.

These techniques should be applied in a complementary manner, as each provides different information about the structural integrity and functional state of the complex.

How should researchers approach deletion analysis to map functional domains in cyoD?

Deletion analysis has been instrumental in identifying that the C-terminal two-third (Val45 to His109) of cyoD, containing helices II and III, is essential for oxidase function . When designing deletion studies, researchers should:

Verification StepTechniqueExpected Outcome for Properly Designed Deletions
Expression levelWestern blotDetectable protein at expected molecular weight
Membrane integrationMembrane fractionationLocalization to membrane fraction
Folding qualityCD spectroscopyMaintenance of secondary structure elements
Complex assemblyBlue native PAGEAssociation with other oxidase subunits
  • Functional correlation: Systematically assess the relationship between truncation position and functional parameters (activity, spectroscopic properties, CuB incorporation) to map domain-function relationships.

This systematic approach allows researchers to precisely define which regions of cyoD are essential for different aspects of its function in the oxidase complex.

How should researchers interpret the results of cyoD deletion and mutation studies in relation to oxidase function?

Interpretation of cyoD mutation effects requires careful consideration of multiple parameters:

  • Primary vs. secondary effects framework: Distinguish between direct effects on cyoD function and indirect consequences for complex assembly using the following analytical approach:

ObservationPrimary Effect InterpretationSecondary Effect Interpretation
Reduced expressionMutation affects protein stabilityNormal but rapid degradation of misassembled complex
Altered spectroscopyDirect interference with cofactor bindingChanges in complex architecture affecting spectral properties
Loss of activityDisruption of catalytic functionFailure of proper complex assembly

These analytical approaches help translate experimental observations into mechanistic insights about cyoD's role in oxidase function.

What bioinformatic approaches can enhance the analysis of cyoD homologs across bacterial species?

Comparative bioinformatic analysis provides valuable context for experimental findings on cyoD:

  • Sequence conservation mapping: Multiple sequence alignment of cyoD homologs across diverse bacterial species reveals:

    • Universally conserved residues likely critical for core function

    • Clade-specific conservation patterns that may reflect specialized adaptations

    • Variable regions potentially involved in species-specific interactions

  • Structural prediction integration:

Analysis TypeToolsApplication to CyoD Research
Transmembrane topologyTMHMM, PhobiusPredict membrane-spanning regions across homologs
Secondary structurePSIPRED, JPredIdentify conserved structural elements
Coevolution analysisEVcouplings, RaptorXPredict residue contacts within and between subunits
Homology modelingSWISS-MODEL, I-TASSERGenerate structural models for comparative analysis
  • Phylogenetic profiling: Correlate the presence/absence of cyoD with specific metabolic capabilities across bacterial species to infer functional associations beyond the known oxidase complex.

  • Gene neighborhood analysis: Examine conservation of gene order in the cyo operon across species to identify functionally linked genes that may participate in assembly or regulation.

  • Molecular clock analysis: Determine evolutionary rates across different regions of cyoD to identify domains under purifying or diversifying selection.

These computational approaches complement experimental data by placing findings in an evolutionary context and generating testable hypotheses about structure-function relationships.

What emerging technologies may advance our understanding of cyoD function and interactions?

Several cutting-edge methodologies hold promise for deepening our understanding of cyoD:

  • Cryo-electron microscopy (cryo-EM): Recent advances in single-particle analysis can potentially resolve the structure of the entire bo-type ubiquinol oxidase complex at near-atomic resolution, revealing the precise positioning of cyoD and its interactions with other subunits.

  • Integrative structural biology approaches: Combining multiple data sources (cross-linking, EPR constraints, computational modeling) can generate comprehensive structural models even in the absence of high-resolution crystal structures.

  • Advanced genetic techniques:

TechniqueApplication to CyoD ResearchExpected Insights
CRISPR interferenceTunable repression of cyoD expressionThreshold levels required for function
In vivo crosslinkingCapture of transient assembly intermediatesSequential assembly pathway identification
Deep mutational scanningComprehensive mutation-function mappingComplete functional landscape of protein
  • Single-molecule techniques: Förster resonance energy transfer (FRET) or atomic force microscopy (AFM) could track the dynamics of complex assembly with labeled subunits, revealing the temporal sequence of interactions involving cyoD.

  • Time-resolved structural methods: Techniques such as time-resolved X-ray solution scattering or time-resolved cryo-EM may capture intermediate states during complex assembly, illuminating cyoD's dynamic role.

These emerging approaches promise to address persistent questions about the temporal and spatial aspects of cyoD's function in oxidase assembly and activity.

How can understanding cyoD function contribute to applied research in biotechnology and medicine?

Knowledge of cyoD structure and function has potential applications beyond basic science:

  • Antimicrobial development: As part of the terminal oxidase complex essential for aerobic respiration in many bacteria, cyoD represents a potential target for novel antibiotics. Understanding its structure and function could guide rational drug design targeting bacterial respiration.

  • Protein engineering applications: Insights from cyoD's role in facilitating metallocenter assembly could inform the design of artificial metalloproteins for catalytic or biosensing applications.

  • Synthetic biology platforms: Engineered oxidase complexes with modified cyoD variants might enable:

    • Bioremediation systems with altered substrate specificity

    • Biosensors for environmental oxygen monitoring

    • Biofuel cells with enhanced electron transfer capabilities

  • Structural biology method development: The challenges of membrane protein expression and complex assembly exemplified by cyoD research drive improvements in methodology that benefit the broader field.

  • Evolutionary medicine perspectives: Comparative analysis of cyoD function across bacterial pathogens can reveal adaptations to different host environments, potentially informing our understanding of host-pathogen interactions.

By connecting fundamental research on cyoD to these applied domains, researchers can enhance the impact and funding opportunities for basic science investigations while addressing significant societal challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.