Recombinant Cytochrome o ubiquinol oxidase subunit 3 (cyoC)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Cytochrome o ubiquinol oxidase subunit 3 (cyoC) is produced via heterologous expression in E. coli systems, enabling detailed biochemical and structural studies . It forms part of the four-subunit cytochrome bo₃ complex (subunits I–IV), which belongs to the heme-copper oxidase superfamily . This complex functions as a terminal oxidase in the E. coli aerobic respiratory chain, coupling electron transfer from ubiquinol to oxygen with proton pumping .

Primary and Tertiary Structure

  • Molecular Weight: 20.5 kDa (204 amino acids) .

  • Domains: Five transmembrane helices, with periplasmic and cytoplasmic loops .

  • Post-Translational Modifications: Binds heme O and participates in stabilizing the quaternary structure of the oxidase complex .

Cryo-EM Insights

The subunit III structure was resolved to 3.15 Å using cryo-electron microscopy (cryo-EM), revealing its role in maintaining the dimeric interface of the cytochrome bo₃ complex . Key structural features include:

ParameterDetails
PDB ID8f68 (monomer), 8f6c (dimer)
Resolution3.15 Å (monomer), 3.46 Å (dimer)
SymmetryC2 symmetry in dimeric form
Interacting SubunitsInterfaces with subunit IV in dimeric assembly

Mechanistic Contributions

  • Proton Translocation: Facilitates proton pumping via a conserved hydrogen-bonding network involving Glu56 and Ser139 residues .

  • Electron Transfer: While redox-active hemes are located in subunit I, cyoC stabilizes the ubiquinol-binding site in subunit II .

  • Dimerization: Structural flexibility in residues 67–74 of subunit III allows conformational shifts during dimer formation .

Genetic Studies

  • Fusion of cyoC with subunits I and II retains oxidase activity, confirming its structural rather than catalytic role .

  • Inactivation of cyoC in Pseudomonas putida disrupts catabolic repression, linking respiratory efficiency to metabolic regulation .

Production Details

  • Expression Host: E. coli .

  • Tag: N-terminal His-tag for affinity purification .

  • Purity: >90% via SDS-PAGE .

Physicochemical Properties

PropertyValue
UniProt IDP0ABJ3
Theoretical pI9.3
Storage BufferTris/PBS with 6% trehalose (pH 8.0)

Research Applications

  • Biochemical Assays: Used to study proton-coupled electron transfer mechanisms .

  • Structural Biology: Key for cryo-EM and X-ray crystallography studies of bacterial oxidases .

  • Metabolic Engineering: Inactivation studies reveal its role in alleviating catabolic repression during hydrocarbon metabolism .

Key Research Findings

  • Dimerization Mechanism: Subunit III undergoes loop rearrangement (residues 67–74) to accommodate dimer formation without altering monomeric functionality .

  • Evolutionary Conservation: Despite low sequence homology, its structural topology aligns with mitochondrial cytochrome c oxidase subunit III .

  • Industrial Relevance: Engineered cyoC variants are explored for optimizing microbial respiration in biotechnological applications .

Open Questions and Future Directions

  • Dynamic Role in Proton Pumping: How do conformational changes in cyoC modulate proton translocation efficiency?

  • Regulatory Interactions: Does cyoC directly influence transcriptional regulation, or are its metabolic effects indirect?

  • Biotechnological Applications: Can cyoC modifications enhance bioenergy production in synthetic microbial systems?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cyoC; c0541; Cytochrome bo(3 ubiquinol oxidase subunit 3; Cytochrome o ubiquinol oxidase subunit 3; Cytochrome o subunit 3; Oxidase bo(3 subunit 3; Ubiquinol oxidase chain C; Ubiquinol oxidase polypeptide III; Ubiquinol oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
cyoC
Target Protein Sequence
MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL SLFWHFLDVVWICVFTVVYLMGAM
Uniprot No.

Target Background

Function

Cytochrome bo(3) ubiquinol terminal oxidase is a key component of the aerobic respiratory chain in E. coli, predominantly expressed under high aeration conditions. Beyond electron transfer, it exhibits proton pump activity across the membrane, transporting 2 protons per electron.

Database Links

KEGG: ecc:c0541

STRING: 199310.c0541

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome o ubiquinol oxidase subunit 3 (cyoC) and what is its structural organization?

Cytochrome o ubiquinol oxidase subunit 3 (cyoC) is a critical component of the cytochrome o oxidase complex, which functions as one of the terminal ubiquinol oxidases in bacterial respiratory chains . The cyoC gene forms part of the cyoABCDE cluster, encoding subunits of the cytochrome o oxidase complex . This gene cluster is responsible for producing subunits II, I, III, and IV of the complex, along with heme o synthase .

For recombinant expression studies, researchers must consider these structural aspects when designing constructs to ensure proper folding and membrane integration.

How does cyoC functionally interact with other subunits in the respiratory complex?

The functional integration of cyoC with other subunits is essential for proper electron transport activity. Cytochrome o ubiquinol oxidase consists of five subunits in E. coli, with three of them (subunits I, II, and III) showing homology to mitochondrial-encoded subunits of eukaryotic aa3-type cytochrome c oxidase . These homologous relationships indicate evolutionary conservation of functional mechanisms.

Research has demonstrated that the spatial arrangement of these subunits is critical for electron transfer. Experiments involving genetic fusion of subunits I, II, and III have shown that linking the C-terminus of subunit II to the N-terminus of subunit I produces a fully functional oxidase . This finding supports the topological model where the N-terminus of subunit I is located on the periplasmic side of the bacterial membrane .

The extensive interactions between cyoC and other subunits provide multiple research targets for understanding electron transport mechanisms. When designing experiments to characterize these interactions, researchers should consider both direct physical contacts and functional dependencies among the subunits.

What experimental approaches are most effective for expressing recombinant cyoC?

For successful recombinant expression of cyoC, researchers must address several methodological challenges related to membrane protein expression:

  • Expression system selection: E. coli-based systems remain the most common choice for bacterial membrane proteins, though Pseudomonas-based systems may offer advantages for expression of Pseudomonas proteins to maintain native folding environments.

  • Fusion tag strategies: N-terminal or C-terminal tags must be carefully positioned to avoid disrupting membrane insertion. Evidence from genetic fusion experiments indicates that linking protein termini across the membrane can be functionally viable if properly designed .

  • Membrane fraction isolation: After expression, gentle cell lysis followed by differential centrifugation effectively separates membrane fractions containing the recombinant cyoC protein.

  • Detergent solubilization: Selection of appropriate detergents is critical for extracting cyoC from membranes while maintaining native-like folding and function.

For verification of proper expression, Western blotting with antibodies against cyoC or attached epitope tags, combined with activity assays measuring ubiquinol oxidation, provides comprehensive validation of the recombinant protein.

How does inactivation of cyoC affect bacterial metabolism and catabolic repression?

The inactivation of cytochrome o ubiquinol oxidase through mutations in the cyo complex has significant impacts on bacterial metabolism, particularly affecting catabolic repression mechanisms. Research with Pseudomonas putida has revealed that disruption of the cytochrome o ubiquinol oxidase relieves catabolic repression under various growth conditions .

In P. putida GPo1, which contains the OCT plasmid encoding an alkane degradation pathway, inactivation of genes in the cyo cluster (including cyoC) reduces the catabolic repression observed when cells grow in rich medium (LB) or defined media containing preferred carbon sources like lactate or succinate . Specifically, when the cyoC gene was interrupted by transposon insertion, the expression of alkane degradation pathway genes increased significantly despite the presence of repressing carbon sources .

The molecular mechanism behind this phenomenon appears to involve the electron transport chain's role in sensing the cell's metabolic or redox state . This suggests that catabolic repression systems may monitor electron flow through respiratory complexes to regulate gene expression based on cellular energy status.

Experiments quantifying this effect showed approximately sevenfold higher transcript levels from the PalkB and PalkS2 promoters in cytochrome o mutants compared to wild-type strains during growth in rich medium . This effect was not attributable to growth rate changes, as the mutant strains grew similarly to wild-type under the tested conditions .

What are the methodological approaches for studying cyoC transmembrane topology?

Determining the transmembrane topology of cyoC presents significant methodological challenges that require combining multiple experimental approaches:

  • Genetic fusion analysis: Creating in-frame fusions between cyoC and reporter proteins (such as alkaline phosphatase or β-galactosidase) at different positions can reveal the membrane orientation of specific protein segments .

  • Cysteine scanning mutagenesis: Systematic replacement of residues with cysteine followed by accessibility studies using membrane-permeable and impermeable sulfhydryl reagents helps map transmembrane domains.

  • Protease protection assays: Limited proteolysis of membrane vesicles with defined orientation can identify exposed protein regions.

  • Computational prediction validation: Experimental data should be compared with hydropathy profiles and transmembrane prediction algorithms, which suggest cyoC typically contains 7 transmembrane spans in most organisms .

Research has revealed interesting topological variations between bacterial and eukaryotic cytochrome oxidase subunits. For example, while subunit I in E. coli contains additional transmembrane helices compared to eukaryotic counterparts, subunit III has fewer membrane-spanning segments . This structural divergence highlights the importance of experimental topology determination rather than relying solely on homology predictions.

How do mutations in cyoC impact electron transport efficiency and bacterial physiology?

Mutations in cyoC can have profound effects on electron transport and bacterial physiology, making this an important area for structure-function research. The cytochrome o ubiquinol oxidase serves as a major terminal oxidase under high-oxygen conditions, and alterations to cyoC can redirect electron flow through alternative terminal oxidases .

Experimental approaches to study these effects include:

  • Site-directed mutagenesis: Targeted mutations of conserved residues in cyoC can identify amino acids critical for proton translocation, ubiquinol binding, or subunit interactions.

  • Oxygen consumption measurements: Polarographic techniques with membrane vesicles or whole cells can quantify changes in respiratory activity resulting from cyoC mutations.

  • Membrane potential assessments: Fluorescent probes that respond to proton gradients can evaluate how cyoC mutations affect the proton-pumping efficiency of the oxidase complex.

  • Growth phenotype characterization: Comparison of growth rates under different oxygen tensions or with various carbon sources reveals physiological adaptations to cyoC mutations.

What are the optimal conditions for assaying recombinant cyoC activity?

The enzymatic activity of recombinant cytochrome o ubiquinol oxidase containing cyoC can be measured using several complementary approaches, each requiring specific experimental conditions:

Table 1: Experimental Conditions for cyoC Activity Assays

Assay TypeBuffer CompositionTemperatureDetection MethodKey Considerations
Oxygen consumption50 mM potassium phosphate (pH 7.0), 100 mM KCl30°CClark-type electrodeRequires intact membrane vesicles or reconstituted proteoliposomes
Ubiquinol oxidation20 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.05% DDM25°CSpectrophotometric (275 nm)Detergent selection critical for maintaining activity
Proton pumping10 mM HEPES (pH 7.4), 100 mM KCl, 5 mM MgCl₂37°CpH-sensitive fluorescent dyesMust control for buffer capacity and establish inward-out vesicle orientation

When designing activity assays, researchers should consider that cytochrome o ubiquinol oxidase functions optimally under highly aerobic conditions . The protein complex requires proper association of all subunits, including cyoC, for maximum electron transport efficiency . Additionally, the assay system should account for potential alternative terminal oxidases that may compensate for cyoC mutations or inactivation .

For recombinant systems, verification of proper membrane insertion and folding is essential before activity measurements. Solubilized preparations require careful detergent selection to maintain the native-like environment necessary for cytochrome o oxidase function.

How can high-dimensional data analysis techniques enhance cyoC research?

Modern research on membrane proteins like cyoC increasingly employs high-dimensional data analysis techniques to extract meaningful patterns from complex datasets. Cytometry and other high-throughput approaches can be particularly valuable for studying the effects of cyoC manipulation on cellular physiology:

  • Flow cytometry applications: Flow cytometry combined with membrane potential-sensitive dyes can measure the impact of cyoC modifications on respiratory activity at the single-cell level .

  • Batch correction methods: When studying cyoC across multiple experiments or time points, batch correction algorithms like Harmony can remove unwanted technical variability while preserving biological differences . This is particularly important for long-term studies where instrument performance may vary.

  • Dimensionality reduction: Techniques such as UMAP (Uniform Manifold Approximation and Projection) help visualize high-dimensional cyoC phenotypic data in a two-dimensional space, revealing patterns not evident in individual parameters .

  • Clustering approaches: Unsupervised clustering identifies cell populations with distinct respiratory phenotypes following genetic manipulation of cyoC or related genes .

The cyCONDOR toolkit exemplifies comprehensive approaches for high-dimensional data analysis, offering data transformation, batch correction, and dimensionality reduction capabilities . Such tools are invaluable when exploring the complex effects of cyoC mutations on cellular phenotypes across diverse conditions.

When implementing these analytical approaches, researchers should carefully validate that batch correction does not eliminate true biological variation attributable to cyoC manipulation while removing technical artifacts.

How can researchers resolve contradictory findings regarding cyoC function?

When facing contradictory results in cyoC research, researchers should employ a systematic troubleshooting approach:

  • Experimental system differences: Compare the specific bacterial strains used, as genetic background can significantly influence cyoC function. For example, studies in P. putida versus E. coli may yield different results due to variations in respiratory chain organization .

  • Growth condition variability: Examine oxygen availability, growth phase, and media composition, as these factors affect terminal oxidase expression and activity. The catabolic repression effects of cyoC mutations are particularly sensitive to carbon source availability .

  • Construct design variations: Differences in recombinant protein design, including fusion partners, purification tags, or expression systems, can lead to seemingly contradictory functional results .

  • Alternative oxidase compensation: Consider whether alternative terminal oxidases might be compensating for cyoC manipulation differently across experimental systems .

  • Technical approach differences: Methodological variations in measuring electron transport, proton pumping, or expression levels can produce apparently conflicting data.

Cross-validation using multiple independent techniques provides the most robust approach to resolving contradictions. For example, combining genetic, biochemical, and biophysical measurements of cyoC function can reveal whether discrepancies arise from biological complexity or methodological differences.

What are the most common technical challenges in purifying recombinant cyoC and how can they be overcome?

Purification of recombinant cyoC presents several technical challenges due to its membrane-embedded nature:

  • Solubilization efficiency: Many researchers encounter poor extraction of cyoC from membranes. This can be addressed by screening multiple detergents (including DDM, LMNG, and digitonin) at various concentrations and temperatures. Detergent mixtures often provide better solubilization while preserving native-like conformation.

  • Protein stability: cyoC may exhibit limited stability once removed from the membrane environment. Inclusion of lipids (0.01-0.1 mg/mL) during purification and glycerol (10-20%) in storage buffers can significantly enhance stability.

  • Complex dissociation: cyoC naturally exists in a multi-subunit complex, and purification procedures may disrupt critical interactions. Mild solubilization conditions and co-expression with other oxidase subunits can help maintain complex integrity .

  • Yield limitations: Low expression levels often hamper structural studies. Codon optimization for the expression host and cultivation at lower temperatures (16-25°C) can improve yields of properly folded protein.

  • Functional validation: Confirming that purified cyoC retains native-like properties requires careful activity measurements. Reconstitution into proteoliposomes prior to functional assays provides a more native-like environment for activity assessment.

When designing genetic constructs, researchers should consider that genetic fusion experiments have demonstrated functional tolerance to certain terminal modifications, suggesting potential strategies for adding purification tags without compromising activity .

How might system-level analysis of cyoC networks inform metabolic engineering approaches?

The connection between cyoC and catabolic repression revealed by genetic studies points to promising systems biology approaches for metabolic engineering . Future research directions should explore:

  • Global regulatory network mapping: Comprehensive transcriptomic and proteomic profiling following cyoC manipulation can identify all affected metabolic pathways, potentially revealing new targets for engineering efforts.

  • Electron flux modeling: Mathematical modeling of electron flow through respiratory chains with altered cyoC function could predict optimal engineering strategies for redirecting metabolic flux.

  • Synthetic biology applications: Engineered cyoC variants with altered regulatory properties might allow fine-tuning of catabolic repression to optimize production of desired metabolites under specific growth conditions.

  • Interspecies comparison: Analyzing how cyoC function varies across bacterial species may reveal naturally occurring regulatory mechanisms that could be transferred to industrial production strains.

  • Integration with artificial intelligence approaches: Machine learning algorithms trained on high-dimensional phenotypic data from cyoC variants could identify non-obvious patterns linking respiratory chain function to global metabolism.

The observed connection between cytochrome o oxidase inactivation and relief of catabolic repression provides a mechanistic basis for engineering strains with altered carbon source utilization patterns . By manipulating cyoC and related components, researchers may develop bacterial strains capable of efficiently utilizing multiple carbon sources simultaneously, overcoming traditional limitations in bioprocessing applications.

What emerging techniques might enhance structural studies of cyoC?

Recent technological advances present new opportunities for detailed structural characterization of challenging membrane proteins like cyoC:

  • Cryo-electron microscopy (cryo-EM): The "resolution revolution" in cryo-EM enables structural determination of membrane protein complexes without crystallization. This approach is particularly valuable for studying cyoC in its native complex with other oxidase subunits.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, NMR, HDX-MS, crosslinking-MS) provides complementary structural data that can be integrated into comprehensive models of cyoC structure and dynamics.

  • Native mass spectrometry: Recent advances allow membrane protein complexes to be analyzed by mass spectrometry while preserving non-covalent interactions, revealing subunit stoichiometry and stability.

  • Molecular dynamics simulations: Increasing computational power enables longer, more accurate simulations of cyoC within membrane environments, providing insights into conformational changes during the catalytic cycle.

  • In situ structural biology: Techniques like cryo-electron tomography can visualize cytochrome o oxidase complexes directly within bacterial cells, revealing native arrangements and interactions.

The successful genetic fusion experiments between oxidase subunits suggest potential for protein engineering approaches that might stabilize the complex in specific conformations suitable for structural studies . Such engineered constructs could capture transient states in the electron transfer and proton pumping mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.