Recombinant Cytophaga hutchinsonii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; CHU_1961; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Target Names
mscL
Target Protein Sequence
MSFIGEFKAFAMRGNVVDLAVGVIIGGAFGKIVSSMVDDLIMPIVSIFMGDKGFKDKFFV FGNQTFESLAKAKEAGVPVFAYGNFIQTVIDFTILAFVIFLMVKGMNNLKKKEEAAAPAP VPAEPTKEEQLLTEIRDLLKK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure changes.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cytophaga hutchinsonii and why is its mscL protein significant for research?

Cytophaga hutchinsonii is a gliding Gram-negative bacterium in the phylum Bacteroidetes with remarkable capabilities to rapidly digest crystalline cellulose, despite lacking processive cellobiohydrolases that are typically involved in cellulose digestion . The bacterium employs a unique mechanism involving partial digestion at the cell surface, solubilization and uptake of cellodextrins across the outer membrane, and further digestion within the periplasm .

The large-conductance mechanosensitive channel (mscL) protein is significant for research because:

  • Mechanosensitive channels play crucial roles in bacterial osmoregulation, helping cells respond to changes in osmotic pressure

  • Understanding mscL function may provide insights into how C. hutchinsonii maintains membrane integrity during its unique cellulose degradation processes

  • The protein may contribute to the bacterium's survival in soil environments where osmotic conditions can fluctuate significantly

What are the structural characteristics of the C. hutchinsonii mscL protein?

The C. hutchinsonii mscL protein has the following characteristics:

  • It is a full-length protein consisting of 141 amino acids

  • UniProt ID: Q11TN7

  • Gene name: mscL (also referenced as CHU_1961)

While the three-dimensional structure of C. hutchinsonii mscL has not been fully characterized in the available literature, mechanosensitive channels typically form homopentameric structures with two transmembrane domains per subunit, creating a pore that opens in response to membrane tension.

How is recombinant C. hutchinsonii mscL protein expressed and purified for research applications?

The recombinant C. hutchinsonii mscL protein is expressed and purified using the following methodology:

StepProcedureDetails
Expression systemE. coliCommon host for heterologous protein expression
Vector designN-terminal His-tag fusionFacilitates downstream purification
Protein rangeFull length (1-141 amino acids)Ensures complete functional domain inclusion
Purification methodAffinity chromatographyUtilizing His-tag for selective binding
Final formLyophilized powderEnhances stability for storage
Purity>90%As determined by SDS-PAGE

For experimental use with other C. hutchinsonii proteins, researchers can follow similar methodologies used for expressing and purifying enzymes like Cel5B and Cel9C, which have been successfully expressed in E. coli and purified for functional studies .

What are the optimal storage and handling conditions for the recombinant protein?

Proper storage and handling are crucial for maintaining protein activity. The recommended conditions are:

ParameterRecommendationNotes
Storage temperature-20°C/-80°CLong-term storage
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Maintains stability
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLBrief centrifugation prior to opening recommended
Additives5-50% glycerol (final concentration)Prevents freeze damage; default is 50%
Working storage4°C for up to one weekFor actively used aliquots
Important cautionAvoid repeated freeze-thaw cyclesDamages protein structure and function

These conditions are specifically optimized for the recombinant His-tagged protein to preserve its structural integrity and functional properties.

What methodologies are appropriate for initial functional characterization of the protein?

For initial functional characterization of the C. hutchinsonii mscL protein, researchers should consider these methodological approaches:

  • Electrophysiological studies: Reconstitute the protein into liposomes or planar lipid bilayers for patch-clamp recordings to characterize channel conductance, ion selectivity, and gating properties.

  • Osmotic shock assays: Evaluate bacterial survival under hypoosmotic shock conditions, comparing wild-type and mscL-mutant strains.

  • Fluorescence-based assays: Reconstitute mscL into liposomes loaded with fluorescent dyes to monitor channel opening in response to osmotic gradients.

  • Comparative analysis: Compare functional properties with well-characterized mscL proteins from other bacteria (e.g., E. coli MscL) to identify unique features.

  • Membrane integrity assessment: Test using methodologies similar to those employed for studying the chu_0125 gene (encoding a peptidoglycan-associated lipoprotein), which was found to be critical for membrane integrity in C. hutchinsonii .

How might the mscL channel function in the context of C. hutchinsonii's unique cellulose degradation mechanism?

The potential role of mscL in C. hutchinsonii's cellulose degradation capabilities presents an intriguing research direction. Based on current knowledge of C. hutchinsonii's unique cellulolytic system, the mscL channel may contribute in several ways:

  • Osmoregulation during cellodextrin processing: C. hutchinsonii digests cellulose through a mechanism involving partial degradation at the cell surface, followed by uptake of cellodextrins across the outer membrane and further digestion in the periplasm . This process creates significant concentration gradients of oligosaccharides and could generate osmotic pressure changes that require mechanosensitive channel regulation.

  • Membrane integrity maintenance: Studies have shown that outer membrane integrity is crucial for C. hutchinsonii's ability to degrade crystalline cellulose. For example, deletion of chu_0125, encoding a peptidoglycan-associated lipoprotein (Pal), prevented degradation of the crystalline region of cellulose by disrupting outer membrane integrity . The mscL channel may play a complementary role in maintaining inner membrane integrity during this process.

  • Sensing mechanical stress during cellulose attachment: The bacterium employs a contact-dependent digestion strategy, where direct attachment to cellulose fibers is necessary. This mechanical interaction might generate membrane tension that could be sensed by the mscL channel.

Experimental approaches to investigate these hypotheses could include creating and characterizing mscL deletion mutants, similar to the approaches used for studying other membrane-associated proteins in C. hutchinsonii .

What are the challenges in developing a reconstitution system for biophysical studies of C. hutchinsonii mscL?

Developing an effective reconstitution system for C. hutchinsonii mscL presents several technical challenges that researchers must address:

ChallengeDescriptionPotential Solutions
Protein stability during purificationMembrane proteins often denature when removed from native lipid environmentUse mild detergents (DDM, CHAPS); optimize buffer conditions; maintain low temperatures during purification
Determining optimal lipid compositionLipid environment affects mechanosensitive channel functionTest various lipid compositions; consider including lipids found in C. hutchinsonii membranes; systematically vary cholesterol content
Achieving proper protein orientationUnidirectional insertion is crucial for functional studiesUtilize pH gradients during reconstitution; consider asymmetric reconstitution methods
Verifying successful reconstitutionConfirmation of proper integration into membranesEmploy freeze-fracture electron microscopy; use fluorescently labeled protein; perform functional assays
Maintaining native-like tension sensitivityArtifactual effects on gating tension thresholdsCarefully control membrane curvature and thickness; optimize protein:lipid ratios

Researchers studying C. hutchinsonii proteins have successfully expressed and purified other membrane-associated components, providing methodological precedents that could be adapted for mscL work .

How would site-directed mutagenesis be applied to understand the structure-function relationship in C. hutchinsonii mscL?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationship of the C. hutchinsonii mscL channel. Based on knowledge from other bacterial mechanosensitive channels and the available sequence information , researchers should consider:

  • Identification of key functional domains:

    • Transmembrane domains (predicted from hydropathy analysis)

    • Pore-lining residues (typically hydrophobic in closed state)

    • Tension-sensing regions (often at lipid-protein interface)

    • N and C-terminal domains (regulatory functions)

  • Strategic mutation design:

    • Conserved residue substitutions to test evolutionary constraints

    • Charge substitutions to investigate electrostatic interactions

    • Hydrophobicity alterations in pore-lining regions

    • Cysteine substitutions for accessibility studies and cross-linking experiments

  • Functional characterization of mutants:

    • Patch-clamp analysis of reconstituted mutant channels

    • In vivo osmotic shock survival assays

    • Fluorescence-based techniques to monitor conformational changes

  • Experimental methodology:

    • PCR-based mutagenesis of the cloned mscL gene

    • Expression in expression systems similar to those used for the wild-type protein

    • Purification protocols adjustments based on potential changes in protein properties

The approach could follow methodologies similar to those employed for studying other C. hutchinsonii proteins, such as the endoglucanases where chromosomal deletions and complementation studies were successfully performed .

What approaches can resolve potential experimental contradictions when studying mscL function in native versus reconstituted systems?

When studying mechanosensitive channels, researchers often encounter discrepancies between results obtained in native cellular environments versus reconstituted systems. To resolve such contradictions when working with C. hutchinsonii mscL:

  • Systematic comparative analysis:

    • Conduct parallel experiments in both systems under identical conditions

    • Develop quantitative metrics for direct comparison (e.g., tension sensitivity, conductance)

    • Document differences in lipid composition between native and artificial membranes

  • Environmental parameter control:

    • Systematically vary lipid composition in reconstituted systems to match native membrane properties

    • Test effects of cytoplasmic factors by adding cellular extracts to reconstituted channels

    • Examine influence of membrane curvature and thickness on channel behavior

  • Advanced methodological approaches:

    • Use spheroplast patch-clamp for near-native conditions while maintaining experimental control

    • Develop supported native membrane patches as an intermediate approach

    • Employ nanodiscs with native lipid extracts for a more physiological reconstitution

  • Data integration framework:

    • Develop mathematical models that account for differences in experimental systems

    • Use Bayesian analysis to integrate data from multiple experimental approaches

    • Apply molecular dynamics simulations to predict behavior across different membrane environments

These approaches could build upon methodologies used for studying other membrane proteins in C. hutchinsonii, such as those employed in investigating the role of the peptidoglycan-associated lipoprotein in membrane integrity .

How might the study of C. hutchinsonii mscL contribute to broader understanding of bacterial mechanosensing in specialized ecological niches?

Investigating C. hutchinsonii mscL offers unique opportunities to expand our understanding of bacterial mechanosensing in specialized ecological contexts:

  • Adaptation to soil environments:

    • C. hutchinsonii thrives in soil where osmotic conditions fluctuate significantly

    • Comparative analysis with mscL channels from bacteria in different habitats could reveal niche-specific adaptations

    • The protein may have evolved specific properties to handle osmotic challenges during cellulose degradation

  • Integration with specialized cellular functions:

    • The bacterium's gliding motility and cellulose degradation capabilities may impose unique demands on mechanosensitive regulation

    • Studies could reveal how mscL function is integrated with specialized cellular processes

    • There may be novel interactions between mscL and components of the cellulose utilization system

  • Evolutionary implications:

    • C. hutchinsonii belongs to the Bacteroidetes phylum, offering evolutionary insights distinct from well-studied proteobacterial mechanosensitive channels

    • Comparative genomics combined with functional studies could reveal evolutionary adaptations in mechanosensing systems

    • The cellulose degradation capability of C. hutchinsonii may have co-evolved with specialized mechanosensing properties

  • Methodological advances:

    • Techniques developed to study this challenging system could advance membrane protein research broadly

    • Integration of genetic manipulation methods established for C. hutchinsonii with biophysical approaches would create a powerful experimental platform

    • Multi-scale approaches combining molecular, cellular, and ecological studies could provide a template for studying other specialized bacterial systems

This research direction connects to ongoing work on C. hutchinsonii's unique cellulose degradation mechanisms, where membrane integrity has already been established as crucial for function .

What parameters should be optimized when designing electrophysiological studies of C. hutchinsonii mscL?

Electrophysiological characterization of C. hutchinsonii mscL requires careful optimization of experimental parameters:

ParameterConsiderationsRecommended Approach
Membrane compositionLipid composition affects channel gatingTest various PC:PE:PG ratios; include bacterial lipid extracts; vary membrane thickness
Applied tensionDetermining gating threshold accuratelyUse pressure clamps with precise control; standardize membrane curvature; employ pressure ramps rather than steps
Recording configurationDifferent setups offer various advantagesCompare inside-out, outside-out, and planar bilayer recordings; document differences systematically
Ionic conditionsIon selectivity and conductance measurementsTest physiologically relevant ion concentrations; examine effects of divalent cations; measure reversal potentials
TemperatureChannel kinetics are temperature-dependentConduct experiments at C. hutchinsonii's optimal growth temperature (30°C); compare with standard recording temperatures
Solution flowMinimizing unstirred layer effectsImplement controlled perfusion systems; monitor access resistance; ensure rapid solution exchange

When implementing these parameters, researchers can draw on methodologies used for other C. hutchinsonii proteins, adapting experimental conditions to match the bacterium's natural environment .

How can researchers effectively combine genetic and biophysical approaches to study C. hutchinsonii mscL?

An integrated approach combining genetic manipulation and biophysical characterization offers powerful insights into C. hutchinsonii mscL function:

  • Genetic system development:

    • Utilize established genetic tools for C. hutchinsonii, such as the in-frame chromosomal deletion methods using rpsL-containing suicide vectors (pYT282, pYT160) that have been successfully applied to other genes

    • Implement complementation strategies similar to those used for cel5B and cel9C genes

    • Develop regulated expression systems to control mscL levels

  • Phenotypic characterization of genetic variants:

    • Assess growth under osmotic challenge conditions

    • Examine membrane integrity using approaches similar to those employed for chu_0125 deletion studies

    • Evaluate cellulose degradation capabilities of mscL mutants using established assays

  • Protein purification from mutant strains:

    • Express and purify mutant variants using established protocols for C. hutchinsonii proteins

    • Compare biochemical properties with wild-type protein

    • Assess oligomeric state and stability differences

  • Functional reconstitution studies:

    • Perform side-by-side electrophysiological characterization of wild-type and mutant channels

    • Correlate in vitro biophysical properties with in vivo phenotypes

    • Develop mathematical models to explain how molecular changes affect cellular physiology

This integrated approach builds upon successful strategies previously employed for studying other functional proteins in C. hutchinsonii .

How should researchers interpret differences between C. hutchinsonii mscL and better-characterized bacterial mechanosensitive channels?

When comparing C. hutchinsonii mscL to well-characterized mechanosensitive channels (e.g., from E. coli or M. tuberculosis), researchers should employ a systematic interpretive framework:

  • Sequence-structure-function correlation:

    • Identify conserved versus divergent residues across bacterial mscL proteins

    • Correlate unique sequence features with functional differences

    • Consider how C. hutchinsonii's ecological niche might explain functional adaptations

  • Contextualizing differences:

    • Distinguish between fundamental mechanistic differences and species-specific adaptations

    • Consider phylogenetic relationships when interpreting functional variations

    • Evaluate differences in terms of membrane composition of source organisms

  • Experimental validation of hypothesized differences:

    • Design chimeric channels to map functional differences to specific protein regions

    • Perform reciprocal mutations to test whether unique properties can be transferred between channels

    • Develop computational models that predict functional consequences of sequence differences

  • Ecological and evolutionary perspective:

    • Consider how C. hutchinsonii's soil habitat and cellulose utilization capabilities might influence mscL properties

    • Examine potential co-evolution with other membrane components

    • Evaluate whether unique properties offer selective advantages in the bacterium's natural environment

This interpretive approach connects to the established understanding of C. hutchinsonii's unique cellular physiology and ecological adaptations .

What analytical frameworks help resolve apparently contradictory results in mscL research?

Mechanosensitive channel research often produces seemingly contradictory results due to the complex interplay of factors affecting channel function. When encountering contradictions in C. hutchinsonii mscL research, apply these analytical frameworks:

  • Systematic parameter variation analysis:

    • Create multidimensional parameter spaces to identify conditions where contradictions arise

    • Use factorial experimental designs to reveal interaction effects between experimental variables

    • Develop quantitative models that identify threshold effects or nonlinear responses

  • Technical limitation assessment:

    • Critically evaluate measurement artifacts specific to each technique

    • Determine detection limits and signal-to-noise ratios for each method

    • Consider temporal resolution differences between techniques

  • Contextual reconciliation approaches:

    • Identify specific conditions where contradictions disappear

    • Develop unifying models that accommodate apparently conflicting observations

    • Use Bayesian statistical frameworks to integrate diverse data types

  • Multi-scale interpretation framework:

    • Connect molecular observations to cellular phenotypes

    • Consider emergent properties that appear at higher levels of organization

    • Develop mathematical models spanning from molecular to cellular scales

These frameworks would be particularly valuable when integrating results from genetic studies (like those performed for C. hutchinsonii cellulases) with biophysical characterization of the mscL protein.

What emerging technologies could advance understanding of C. hutchinsonii mscL function in cellular physiology?

Several cutting-edge technologies hold promise for elucidating the role of mscL in C. hutchinsonii's unique physiology:

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize mscL distribution during cellulose attachment

    • Single-molecule tracking to monitor channel dynamics in living cells

    • Correlative light and electron microscopy to connect mscL localization with cellular ultrastructure

  • High-throughput functional genomics:

    • CRISPR interference systems adapted for C. hutchinsonii to create conditional knockdowns

    • Transposon sequencing to identify genetic interactions with mscL

    • RNA-seq analysis under osmotic challenge conditions to map regulatory networks

  • Novel biophysical methods:

    • Magnetic tweezers combined with patch-clamp to precisely control membrane tension

    • Mass photometry to determine oligomeric states in different membrane environments

    • Cryo-electron tomography to visualize channels in near-native conditions

  • Systems biology approaches:

    • Multi-omics integration to place mscL function in broader cellular context

    • Flux balance analysis with regulated mscL expression to quantify physiological impact

    • Agent-based modeling of cellulose degradation incorporating mechanosensitive regulation

These approaches could build upon methodologies used for studying C. hutchinsonii's cellulose utilization system , creating a more comprehensive understanding of how mscL contributes to the bacterium's specialized physiology.

How might research on C. hutchinsonii mscL contribute to biotechnological applications?

Understanding C. hutchinsonii mscL could lead to several innovative biotechnological applications:

  • Enhanced cellulose degradation systems:

    • Engineering cellulolytic microorganisms with optimized mechanosensing for improved performance

    • Developing strains with increased osmotic tolerance during biofuel production processes

    • Creating synthetic cellulose utilization systems incorporating mechanosensitive regulation

  • Biosensor development:

    • Designing tension-sensitive protein switches based on mscL principles

    • Creating whole-cell biosensors for environmental monitoring

    • Developing diagnostic platforms for detecting mechanical perturbations

  • Membrane protein engineering:

    • Using insights from C. hutchinsonii mscL to improve heterologous membrane protein expression

    • Designing channels with novel gating properties for controlled release applications

    • Creating chimeric proteins with specialized functions

  • Therapeutic delivery systems:

    • Developing mechanosensitive liposomes for targeted drug delivery

    • Creating cellular delivery systems responsive to tissue mechanical properties

    • Engineering probiotic bacteria with controlled permeability for therapeutic applications

These biotechnological directions connect to the established potential of C. hutchinsonii as a source of novel proteins to increase the efficiency of conversion of cellulose into soluble sugars and biofuels .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.