Recombinant Cytophaga hutchinsonii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC in Bacterial Systems

The YidC protein is a universally conserved membrane insertase critical for the co-translational integration of membrane proteins in bacteria. It operates either independently or synergistically with the Sec translocon, facilitating the transition of nascent polypeptides from the ribosome into the lipid bilayer . YidC’s structural features include a hydrophilic groove formed by transmembrane helices (TMs), which enables substrate interaction and lipid bilayer thinning to reduce energy barriers during insertion .

Cytophaga hutchinsonii and Its Unique Membrane Biology

Cytophaga hutchinsonii is a cellulose-degrading soil bacterium within the Bacteroidetes phylum. Its membrane biology is notable for:

  • Gliding motility: Dependent on outer membrane proteins and secretion systems (e.g., T9SS) .

  • Cellulose utilization: Requires direct contact with cellulose, mediated by cell-associated enzymes and outer membrane proteins .

  • YidC homologs: While genomic studies confirm the presence of YidC homologs in C. hutchinsonii, their recombinant forms and specific roles remain underexplored compared to model organisms like Escherichia coli .

Recombinant YidC in C. hutchinsonii: Current Insights

Recombinant YidC refers to the protein produced via heterologous expression systems for functional and structural studies. Key findings from related systems suggest potential roles and characteristics:

Functional Attributes

FeatureE. coli YidCC. hutchinsonii YidC (Inferred)
Membrane insertionSec-independent (e.g., Pf3 coat) Likely supports T9SS substrates
Cofactor interactionBinds SecYEG and YibN Hypothesized to interact with T9SS
Structural grooveTM3-TM5 hydrophilic groove Conserved core predicted via homology

Research Gaps

  • Direct studies on recombinant C. hutchinsonii YidC are absent in available literature. Current knowledge is extrapolated from:

    1. Evolutionary conservation: Structural models of Bacillus halodurans and E. coli YidC suggest conserved mechanisms .

    2. Functional parallels: C. hutchinsonii’s T9SS-dependent secretion aligns with YidC’s role in substrate delivery to membranes .

Hypothesized Role in C. hutchinsonii Physiology

Recombinant YidC in C. hutchinsonii may contribute to:

  • Cellulose degradation: By inserting cellulolytic enzymes into the outer membrane.

  • Gliding motility: Via integration of motility-associated proteins (e.g., SprA/SprT) .

  • Metal ion uptake: Indirectly supporting systems like T9SS, which require Ca²⁺/Mg²⁺ for function .

Technical Challenges and Future Directions

  1. Heterologous expression: Optimizing C. hutchinsonii YidC production in systems like E. coli or yeast.

  2. Structural characterization: Cryo-EM or X-ray crystallography to resolve its unique helical hairpin (TM2-TM3) and lipid interface .

  3. Functional assays: Testing insertion efficiency using substrates like phage coat proteins (e.g., Pf3) or ATP synthase subunits .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; CHU_2557; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-620
Protein Length
full length protein
Species
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Target Names
yidC
Target Protein Sequence
MDKNQIIGISLISVLMLGYFGFMSTQTPETPVTTPPAITQPVQSDTVLLKSAATDTALKA QNQREYGDFAAAMVGEAKEYKLENKDVVVTLSTKGGTIKSVLLKNYFTWDKKQLFLFKQE NNQLSLILNTNKKPVDLYSLYYAGVESKAGDKQVVTFKTDAGNGKTIEHTYTLGAAGFTV DYNLKAAGFGGELPNLPLTLDWREQVERIEYDSEQARVKSTVNYMAAEDGFDYLSEASKD RETETLSNVYWVSLKQKFFNSGFYIREGGTIPSATVTAYPMYSTLPNAPVNSEKFIKALE AQVQLPLEAVISGKAAYAFYFGPNDFKICKAVPAENYQKNVNLGWPLVSWINRFVVIPVF DGLKGVFSSFGLIIVILVLLIKLVLLPLSYKSFVSMAKMKALKPELDELKAKHGDDQQAI QMEQMQVYKQFGINPLSGCIPVLLQMPILLAMFNFFPNAIDLRGESLWWATDLSSYDEFA KLPFTIPFYGSHVSMFTLLMTISTLAYTWVNNQVSTVTGPMKYMSYAMPVVFLFVLNSFP AGLSFYYFVSNLVTIAQQLIIRRFVDEGQLRLQLEAKRDKNLSGDTTGGAPKKNRFMARM EEAMKQREQEQQFKKNIKKK
Uniprot No.

Target Background

Function

Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It facilitates the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. It also assists in the folding of multispanning membrane proteins.

Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what molecular mechanisms underlie its membrane protein insertion function?

YidC belongs to a conserved family of membrane protein insertases that facilitate the integration of proteins into bacterial membranes. At the molecular level, YidC contains a U-shaped hydrophilic groove that is closed on the periplasmic side but exposed to the cytoplasmic side of the membrane bilayer . This distinctive structural feature creates a specialized environment for substrate protein insertion.

The insertion mechanism involves several steps beginning with substrate recognition. During insertion, YidC undergoes significant conformational changes as indicated by RMSD and radius of gyration analyses . The initial positioning of substrate proteins is facilitated by a "water slide" motion where water molecules within the YidC groove provide a favorable environment for the incoming protein . As the insertion process progresses, the cytoplasmic groove becomes more compact, and water molecules are pushed out, creating a hydrophobic shift that facilitates membrane insertion .

The hydrophilic cavity of YidC plays a crucial role by reducing the energy barrier associated with substrate insertion, effectively shortening the hydrophobic core of the membrane . This structural arrangement allows YidC to mediate the insertion of various membrane proteins with different topologies.

How does YidC relate evolutionarily to other membrane insertion systems?

YidC is homologous to Saccharomyces cerevisiae Oxa1p, which functions in a novel export pathway at the mitochondrial inner membrane . This evolutionary relationship suggests a conserved mechanism for membrane protein insertion across diverse biological systems.

While Oxa1p was initially thought to specifically function in the biogenesis of N-tail proteins (membrane proteins with a long exported N-terminal region), research shows that YidC's role is not restricted to N-tail proteins . It has been found in contact with various nascent membrane proteins that differ in topology and do not possess large translocated N-tails, indicating a broader functional role in membrane protein biogenesis .

What is known about YidC's interactions with other membrane components?

YidC appears to be associated with the bacterial translocase complex, which mediates protein secretion and membrane protein insertion. Immunoblotting studies revealed that overproduction of SecYE or YajCSecDF resulted in a dramatic increase in YidC levels, suggesting a coordinated expression pattern among these components .

Interestingly, upon Ni-NTA chromatography, only a portion of YidC co-purifies with the SecYEG complex, while another portion remains with SecD, SecF, and YajC in the unbound fraction . This observation suggests either a relatively weak association between YidC and SecYEG or the existence of different subcomplexes containing YidC. Previous research identified two heterotrimeric translocase subcomplexes (SecYEG and YajCSecDF) through co-immunoprecipitation, and an unidentified 60 kDa protein co-immunoprecipitated with both subcomplexes, which is likely YidC .

Recent research has also identified YibN as a bona fide interactor of YidC with implications in membrane insertion . This interaction was validated using affinity pulldown with recombinant His-tagged YidC .

What expression systems are optimal for recombinant YidC production?

Based on available data, E. coli appears to be an effective expression system for recombinant YidC proteins. For instance, the Shewanella putrefaciens YidC (although not from C. hutchinsonii) has been successfully expressed in E. coli as a recombinant protein with an N-terminal His tag .

When designing expression constructs for YidC, researchers should consider:

  • The addition of affinity tags (such as His tags) to facilitate purification

  • The position of the tag (N-terminal vs. C-terminal) to minimize interference with function

  • The expression vector system (e.g., pBAD22 has been used successfully for YidC-fusion proteins)

For optimal expression, induction conditions should be carefully optimized considering that YidC is a membrane protein and overexpression might lead to toxicity or inclusion body formation.

What purification strategies yield functional YidC protein?

Purification of membrane proteins like YidC requires specialized approaches. Based on available information, the following strategies are recommended:

  • Membrane isolation: Carefully isolate bacterial inner membranes containing the expressed YidC protein

  • Solubilization: Use appropriate detergents like DDM (1%) to solubilize the membrane proteins

  • Affinity chromatography: For His-tagged YidC, Ni-NTA chromatography provides an effective purification method

  • Storage: Store purified YidC as a lyophilized powder or in appropriate buffer conditions with stabilizing agents

Specifically for His-tagged recombinant proteins (like the Shewanella putrefaciens YidC example), maintaining protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been shown to be effective .

What methodological approaches can be used to study YidC-substrate interactions?

Several complementary approaches have proven valuable for investigating YidC-substrate interactions:

  • BioID proximity labeling: This technique uses a mutant biotin ligase (BirA*) fused to YidC to identify proteins in close proximity. After expression and membrane isolation, biotinylated proteins can be captured with NeutrAvidin beads and identified by LC-MS/MS .

  • Cross-linking studies: Similar to studies with the YidC homolog Oxa1p, cross-linking can reveal transient interactions between YidC and nascent membrane proteins .

  • Computational simulations: Molecular dynamics simulations have been employed to study the conformational dynamics of YidC during substrate insertion, including both local and global conformational changes .

  • Affinity pulldown assays: These can validate specific protein-protein interactions, as demonstrated with the YibN-YidC interaction using recombinant His-tagged YidC .

  • SILAC-labeling: Stable isotope labeling with amino acids in cell culture (SILAC) can be used to quantitatively analyze protein interactions, as demonstrated with YidC using Lys4/Lys0 lysine isotopologues .

How does water dynamics in the YidC groove affect membrane protein insertion?

Water content analysis within the YidC groove provides critical insights into the insertion mechanism. Molecular dynamics simulations have revealed that:

  • The number of water molecules within the groove region is higher at the initial stage of insertion (pose1)

  • As insertion progresses (pose2), the water content approaches zero throughout the simulation

This confirms the hypothesis that a water slide motion is important in the initial positioning of substrate proteins. The process follows a defined sequence:

  • The substrate protein enters the YidC groove via the cytoplasmic side

  • The central TM helices widen to form a water slide

  • The YidC groove region fills with water to provide a smooth sliding motion

  • As insertion progresses, the cytoplasmic groove becomes more compact

  • Water molecules are pushed out of the transmembrane groove

  • These changes cause a hydrophobic shift in the region, facilitating membrane insertion

This hydrophilic-to-hydrophobic transition is a key mechanism by which YidC reduces the energy barrier for membrane protein insertion.

What structural changes occur in YidC during the insertion process?

YidC undergoes substantial conformational changes during substrate insertion. These changes can be quantified through:

The proposed mechanism involves:

  • Initial interaction between the substrate protein and YidC cytoplasmic loops

  • Gradual movement of the substrate into the hydrophilic groove

  • Formation of specific salt bridges (e.g., between negatively charged residues of the substrate and positively charged residues like R72 in YidC)

  • Movement of the substrate N-terminal into the deep groove

  • Dehydration of the groove

  • Migration of the substrate towards the periplasmic side, assisted by hydrophobic forces

These structural dynamics are essential for understanding how YidC facilitates membrane protein insertion.

How might YidC function differ in Cytophaga hutchinsonii compared to other bacterial systems?

While specific information about C. hutchinsonii YidC is limited in the available research, we can make informed inferences based on what is known about this bacterium's unique properties:

C. hutchinsonii possesses distinct characteristics related to membrane proteins and cellular function:

  • It is a gliding cellulolytic bacterium ubiquitously distributed in soil

  • It has unique cellulose digestion mechanisms that are still not fully understood

  • Its motility and cellulose utilization are linked to specific membrane proteins

Research on a small periplasmic protein in C. hutchinsonii (CHU_2981) demonstrated that this protein, though not directly related to YidC, plays an important role in both cellulose utilization and cell motility by influencing the production of outer membrane proteins . This suggests that membrane protein biogenesis in C. hutchinsonii might have unique features related to its specialized ecological niche and cellulolytic lifestyle.

When studying YidC in C. hutchinsonii, researchers should consider:

  • Potential adaptations related to its cellulolytic lifestyle

  • Interactions with specialized membrane proteins involved in cellulose digestion

  • Possible connections to motility mechanisms, which are crucial for C. hutchinsonii's interaction with cellulose substrates

What are common challenges in expressing and purifying functional YidC and how can they be addressed?

Membrane proteins like YidC present several challenges in recombinant expression and purification:

  • Protein toxicity during overexpression:

    • Use tightly regulated expression systems (like pBAD)

    • Optimize induction conditions (concentration, temperature, duration)

    • Consider expression in specialized E. coli strains designed for membrane proteins

  • Maintaining protein solubility and stability:

    • For lyophilized YidC preparations, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended

    • Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C can maintain stability

    • Avoiding repeated freeze-thaw cycles is crucial, with working aliquots best stored at 4°C for up to one week

  • Purification challenges:

    • Careful selection of detergents is critical for membrane protein solubilization

    • Optimizing detergent concentration to maintain protein structure while efficiently extracting it from membranes

    • Including stabilizing agents during purification steps

How can researchers address data interpretation challenges in YidC functional studies?

YidC research presents several methodological and interpretive challenges:

  • Distinguishing direct vs. indirect effects:

    • Use complementary approaches (genetic, biochemical, structural)

    • Include appropriate controls to differentiate YidC-specific effects from general membrane perturbations

  • Computational simulation limitations:

    • Model quality and docking accuracy significantly impact simulation results

    • Use multiple docking models, including various substrate proteins in different conformational states

    • Combine computational predictions with experimental validation

  • Variability in YidC-substrate interactions:

    • The substrate-specific nature of YidC interactions requires careful experimental design

    • Consider that YidC might function differently with various substrate proteins

    • Use multiple experimental approaches to build a comprehensive understanding

What emerging methodologies could advance YidC research in C. hutchinsonii and other bacteria?

Several cutting-edge approaches could advance understanding of YidC function:

  • Cryo-electron microscopy (Cryo-EM):

    • Capturing different conformational states of YidC during the insertion process

    • Visualizing YidC-substrate complexes at near-atomic resolution

  • Advanced computational approaches:

    • Integrating molecular dynamics with machine learning to predict substrate specificity

    • Simulating longer timescales to capture complete insertion events

  • Genetic engineering tools for C. hutchinsonii:

    • Developing efficient transformation methods for this bacterium

    • Creating reporter systems to study YidC function in vivo

    • Utilizing transposon mutagenesis approaches that have proven successful for C. hutchinsonii studies

How might understanding YidC function contribute to broader bacterial membrane protein research?

YidC research has significant implications for multiple areas of bacterial biology:

  • Membrane protein biogenesis mechanisms:

    • YidC represents a unique insertion pathway distinct from the Sec translocon

    • Understanding how YidC facilitates insertion could reveal fundamental principles about membrane protein folding and assembly

  • Bacterial adaptation and specialization:

    • Investigating how YidC might be adapted in specialized bacteria like C. hutchinsonii could reveal how membrane protein biogenesis machinery evolves to support specific ecological niches

  • Potential antimicrobial targets:

    • YidC is essential for viability in many bacteria

    • Understanding its mechanism could potentially lead to novel antimicrobial strategies targeting membrane protein biogenesis

  • Biotechnological applications:

    • Improved understanding of YidC could enhance recombinant membrane protein production systems

    • Engineered YidC variants might facilitate expression of challenging membrane proteins for structural and functional studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.