Recombinant Cytophaga hutchinsonii Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytophaga hutchinsonii is a Gram-negative bacterium known for its rapid gliding motility and ability to degrade crystalline cellulose . MtgA, or monofunctional biosynthetic peptidoglycan transglycosylase, is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors .

Genomic Context and Characteristics of C. hutchinsonii

C. hutchinsonii possesses several unique characteristics, including its efficient cellulose digestion and gliding motility . Its genome encodes various enzymes involved in the digestion of cellulose and hemicelluloses, as well as enzymes for peptidoglycan turnover and the utilization of intracellular storage compounds . It carries out aerobic respiration of glucose to $$CO_2$$ through the Embden-Meyerhof-Parnas pathway and the tricarboxylic acid cycle .

Glycosylation System: C. hutchinsonii also possesses an N-glycosylation system, which is generally limited to some pathogenic bacteria in prokaryotes . The glycosyltransferase-related protein GtrA, located in the cytoplasm, is essential for the outer membrane localization of recombinant proteins .

MtgA: Biosynthetic Peptidoglycan Transglycosylase

MtgA is a peptidoglycan polymerase responsible for catalyzing glycan chain elongation using lipid-linked precursors . Peptidoglycans are essential for maintaining the integrity of the outer membrane in bacteria, and peptidoglycan-associated lipoproteins may influence the function of outer membrane proteins, potentially affecting cellulose degradation in C. hutchinsonii .

Functional Studies and Research Findings

GtrA and Cellulose Degradation: Studies have shown that the glycosyltransferase-related protein GtrA (CHU_0012) is essential for the outer membrane localization of glycosylated proteins . Deletion of gtrA decreases the abundance of outer membrane proteins and affects cellulose degradation by C. hutchinsonii .

Peptidoglycan-Associated Lipoprotein: Research indicates that deletion of chu_0125, encoding a putative peptidoglycan-associated lipoprotein, prevents the degradation of the crystalline region of cellulose .

T9SS Components: The Type IX Secretion System (T9SS) is crucial for cellulose utilization and cell motility in C. hutchinsonii . SprA and SprT are essential components of the T9SS, and their deletion results in decreased cell surface cellulase activity and secretion defects of cell surface endoglucanases .

Tables of Enzymes and Proteins in C. hutchinsonii

ProteinDescriptionFunction
GtrA (CHU_0012)Glycosyltransferase-related proteinEssential for outer membrane localization of recombinant proteins; affects cellulose degradation
CHU_0125Putative peptidoglycan-associated lipoproteinInfluences outer membrane integrity; deletion prevents degradation of crystalline cellulose
SprAT9SS componentEssential for cellulose utilization and cell motility; affects secretion of cell surface endoglucanases
SprTT9SS componentEssential for cellulose utilization and cell motility; affects secretion of cell surface endoglucanases
MtgABiosynthetic peptidoglycan transglycosylaseCatalyzes glycan chain elongation from lipid-linked precursors

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. Please specify your required tag type for preferential development.
Synonyms
mtgA; CHU_1314; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Target Names
mtgA
Target Protein Sequence
MYIEIIFSCKQLMKKAKIILLTCCIYFFVYTFQIVLVFKFVNPVVTPLMIVRVAEGVFSK EYVGIRKTWKPIKEISPNMVCAVIASEDHHFLEHNGFDWEAIRAARAYNERHKNGIKRGA STISQQTAKNVFLFPSRSWIRKGFEAYFTFLIELLWSKERIMEMYLNEIEMGKGIYGIEA AAQKYYHIPAKKLSQQQAASIAAILPLPLKRNPLKPGKNTASRVLWIRSQMSSVEKPTWI LKSK
Uniprot No.

Target Background

Function
Peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Cytophaga hutchinsonii and why is it significant in microbiological research?

Cytophaga hutchinsonii is an aerobic cellulolytic soil bacterium belonging to the phylum Bacteroidetes. It possesses two distinctive characteristics that make it significant for research: its rapid gliding motility over surfaces and its contact-dependent digestion of crystalline cellulose. Unlike other cellulolytic bacteria, C. hutchinsonii employs a novel mechanism for cellulose degradation that doesn't involve the typical free soluble cellulase system or multiprotein cellulosome complexes .

The bacterium has a single, circular 4.43-Mb chromosome containing 3,790 open reading frames. C. hutchinsonii utilizes very few substrates as sole carbon and energy sources—primarily crystalline cellulose, with limited ability to use cellobiose and glucose . This selective substrate utilization makes it an interesting model organism for studying specialized metabolic pathways and cell-surface interactions during cellulose degradation.

What is the function of Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in bacterial physiology?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) plays a crucial role in bacterial cell wall biogenesis. The enzyme catalyzes the polymerization of glycan chains in peptidoglycan, which forms the rigid layer of bacterial cell walls. Specifically, mtgA transfers the growing glycan chain to the C-4 hydroxyl group of N-acetylglucosamine residues of lipid II, forming β-1,4-glycosidic bonds.

In C. hutchinsonii, mtgA (encoded by CHU_1314) is particularly important for maintaining cell wall integrity during its unique gliding motility and cellulose degradation processes. The protein functions as a glycan polymerase (also known as peptidoglycan glycosyltransferase), participating in the biosynthetic pathway that provides structural rigidity to the cell while allowing for cell growth and division .

What are the optimal conditions for expressing recombinant C. hutchinsonii mtgA in E. coli?

For optimal expression of recombinant C. hutchinsonii mtgA in E. coli, researchers should consider the following parameters:

Expression System:

  • Host strain: BL21(DE3) or its derivatives provide good expression for proteins requiring tight regulation

  • Vector selection: pET series vectors with T7 promoter systems are effective for controlled expression

  • Codon optimization: Consider codon optimization for C. hutchinsonii genes to improve translation efficiency in E. coli

Culture Conditions:

  • Medium: LB or 2×YT supplemented with appropriate antibiotics

  • Temperature: Lower induction temperatures (16-25°C) may improve soluble protein yields

  • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

  • Post-induction growth: 16-20 hours at reduced temperature (16-18°C)

Optimization Strategies:

  • Addition of osmolytes (sorbitol, glycine betaine) to improve protein folding

  • Co-expression with chaperones (GroEL/GroES, trigger factor) if solubility issues are encountered

  • Testing multiple fusion tags if the N-terminal His-tag affects protein activity

When planning expression experiments, it's advisable to test multiple conditions simultaneously using small-scale cultures before scaling up to production volumes.

What purification strategy yields the highest purity and activity for recombinant mtgA?

A multi-step purification strategy is recommended to obtain high-purity, active recombinant mtgA:

Initial Capture:

  • Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA resin

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash buffer: Same as binding buffer with 20-40 mM imidazole

    • Elution buffer: Same as binding buffer with 250-300 mM imidazole

Intermediate Purification:
2. Ion Exchange Chromatography

  • Based on theoretical pI of mtgA (calculated from sequence)

  • Buffer conditions: 20 mM Tris-HCl pH 8.0, with gradient of 0-500 mM NaCl

Polishing Step:
3. Size Exclusion Chromatography

  • Buffer: 20 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Column selection: Superdex 75 or Superdex 200 depending on aggregation state

Quality Control:

  • SDS-PAGE analysis: >90% purity is typically achievable

  • Western blot verification using anti-His antibodies

  • Dynamic light scattering to assess protein homogeneity

  • Thermal shift assay to determine optimal buffer conditions

Storage Considerations:

  • Addition of 5-50% glycerol (final concentration) for long-term storage

  • Aliquoting and flash-freezing in liquid nitrogen

  • Storage at -80°C for extended stability

How can researchers design effective assays to measure mtgA enzymatic activity?

Designing effective assays for mtgA enzymatic activity requires consideration of its transglycosylase function in peptidoglycan synthesis:

Substrate Preparation:

  • Lipid II substrate synthesis or acquisition from commercial sources

  • Radiolabeled substrates (14C or 3H-labeled lipid II) for high sensitivity assays

  • Fluorescently labeled lipid II analogs for continuous monitoring

Activity Assay Methods:

  • HPLC-based Assay:

    • Separation of reaction products using reverse-phase HPLC

    • Detection of glycan chains of increasing length

    • Quantification based on UV absorbance or radioactivity

  • Fluorescence-based Assay:

    • Using dansylated or BODIPY-labeled lipid II

    • Monitoring fluorescence changes upon polymerization

    • Time-course measurements in 96-well format for high-throughput screening

  • Coupled Enzyme Assay:

    • Using phosphatase-coupled detection of released undecaprenyl pyrophosphate

    • Colorimetric or fluorometric detection of phosphate release

Assay Conditions Optimization:

  • Buffer: 50 mM HEPES pH 7.5, 10 mM MgCl2, 0.08% Triton X-100

  • Temperature range: 25-30°C (reflecting optimal growth temperature of C. hutchinsonii)

  • Divalent cation requirements: Testing effects of Mg2+, Mn2+, and Ca2+

  • Time course: 15-60 minutes depending on enzyme concentration

Controls and Validation:

  • Heat-inactivated enzyme control

  • Known transglycosylase inhibitors (moenomycin) as positive controls

  • Mass spectrometry validation of reaction products

What structural domains characterize C. hutchinsonii mtgA and how do they compare to mtgA from other bacterial species?

C. hutchinsonii mtgA exhibits a domain organization characteristic of monofunctional transglycosylases, but with some distinctive features:

Domain Structure:

  • N-terminal transmembrane domain (residues 1-25): Anchors the protein to the cytoplasmic membrane

  • Catalytic transglycosylase domain (residues ~40-240): Contains the active site for glycan polymerization

  • Possible penicillin-binding protein and serine/threonine kinase associated domain (residues ~100-220)

  • Higher sequence divergence in the N-terminal region compared to well-characterized mtgAs from proteobacteria

  • Conservation of catalytic residues essential for transglycosylase activity

  • Unique sequence elements that may relate to C. hutchinsonii's specialized cell wall architecture

Conserved Motifs:
Several sequence motifs are conserved across bacterial mtgAs, including:

  • E/DXXFXXHXG motif, containing the catalytic glutamate

  • KXXQXXAA motif involved in substrate binding

  • Hydrophobic residues forming the lipid II binding pocket

Sequence alignment studies reveal that while these motifs are present in C. hutchinsonii mtgA, there are subtle variations that may contribute to specific substrate preferences or catalytic properties unique to this organism.

How does the expression of mtgA correlate with the unique gliding motility and cellulose degradation capabilities of C. hutchinsonii?

The expression of mtgA in C. hutchinsonii appears to be intricately linked to its unique gliding motility and cellulose degradation capabilities, though the precise relationship is complex:

Connection to Type IX Secretion System (T9SS):
C. hutchinsonii utilizes a T9SS for the secretion of proteins involved in gliding motility and cellulose degradation. While mtgA itself is not a T9SS substrate, its activity in peptidoglycan synthesis may be coordinated with T9SS function to accommodate the insertion of secretion machinery components into the cell envelope .

Relationship with Gliding Motility:
The expression of mtgA likely needs to be precisely regulated during gliding motility to:

  • Maintain cell wall integrity during movement

  • Allow for localized peptidoglycan remodeling at adhesion sites

  • Accommodate the dynamic reshaping of the cell envelope during gliding

Studies on related bacteria in the phylum Bacteroidetes suggest that peptidoglycan synthesis is coordinated with the gliding motility apparatus, particularly at cell poles where directed movement originates .

Correlation with Cellulose Degradation:
When C. hutchinsonii is grown on cellulose as the sole carbon source, the expression patterns of numerous genes change, including those involved in cell envelope biogenesis. Although direct transcriptomic data for mtgA under these conditions is limited, related studies suggest:

  • Upregulation of cell wall remodeling enzymes during attachment to cellulose fibers

  • Coordinated expression of peptidoglycan synthesis genes with those encoding cellulolytic enzymes

  • Potential localization of peptidoglycan synthesis machinery near sites of cellulose attachment

The relationship between mtgA expression and these specialized cellular functions represents an important area for future research, potentially revealing how C. hutchinsonii coordinates cell wall biogenesis with its unique ecological niche as a cellulose degrader.

What role might mtgA play in the ion uptake mechanisms that have been linked to the T9SS in C. hutchinsonii?

Recent studies have revealed an unexpected connection between the Type IX Secretion System (T9SS) and ion acquisition in C. hutchinsonii, particularly for Ca²⁺ and Mg²⁺ ions. The potential role of mtgA in this process is intriguing and multifaceted:

T9SS-Dependent Ion Uptake:
Studies have shown that deletion of core T9SS components in C. hutchinsonii results in:

  • Dramatically reduced intracellular concentrations of Ca²⁺

  • Growth defects in Ca²⁺- and Mg²⁺-deficient media

  • Altered expression of transport proteins in the outer membrane

Potential Contributions of mtgA:
As a peptidoglycan biosynthesis enzyme, mtgA may influence ion uptake through several mechanisms:

  • Cell Envelope Integrity:

    • mtgA activity maintains proper peptidoglycan architecture, which provides the structural framework for membrane protein complexes

    • Disruption of peptidoglycan synthesis could affect the organization of ion transport systems

  • Periplasmic Space Regulation:

    • The periplasmic space, bounded by peptidoglycan, serves as a compartment for ion storage

    • mtgA activity influences periplasmic volume and charge distribution, potentially affecting ion gradients

  • Coordination with Metal-Binding Proteins:

    • Peptidoglycan itself can bind divalent cations

    • The glycan chains synthesized by mtgA may contribute to metal ion sequestration within the cell envelope

Experimental Evidence from Related Systems:
While direct evidence for mtgA involvement in ion uptake in C. hutchinsonii is limited, studies in related bacteria have shown:

  • Changes in peptidoglycan structure affect metal ion sensitivity

  • Peptidoglycan synthesis is responsive to environmental ion concentrations

  • Cell wall remodeling enzymes are differentially expressed under ion-limited conditions

The intersection of peptidoglycan metabolism, T9SS function, and ion homeostasis represents an emerging area of research in understanding C. hutchinsonii physiology. Further studies specifically targeting mtgA in the context of ion uptake would be valuable for elucidating these connections.

How can researchers utilize recombinant mtgA to investigate the unique cell wall architecture required for gliding motility in C. hutchinsonii?

Investigating the relationship between mtgA, cell wall architecture, and gliding motility in C. hutchinsonii requires sophisticated experimental approaches:

Peptidoglycan Structure Analysis:

  • In vitro Peptidoglycan Synthesis:

    • Using purified recombinant mtgA to synthesize glycan strands

    • Analyzing product length and cross-linking patterns by mass spectrometry

    • Comparing products to peptidoglycan isolated from wild-type and motility-deficient mutants

  • Cell Wall Labeling Strategies:

    • Fluorescent D-amino acid incorporation to visualize sites of active peptidoglycan synthesis

    • Correlating synthesis patterns with gliding direction and velocity

    • Time-lapse microscopy with labeled peptidoglycan to track remodeling during motility

Mutational Analysis:

  • Site-Directed Mutagenesis of mtgA:

    • Creating point mutations in catalytic residues to generate partially active variants

    • Introducing mutations in putative protein-protein interaction sites

    • Expressing mutant proteins in C. hutchinsonii to assess effects on gliding

  • Domain Swapping Experiments:

    • Constructing chimeric proteins with mtgA domains from non-gliding bacteria

    • Identifying domains critical for supporting the gliding phenotype

    • Correlating structural features with functional outcomes

Protein-Protein Interaction Studies:

  • Pull-Down Assays:

    • Using recombinant mtgA as bait to identify binding partners

    • Cross-linking studies to capture transient interactions

    • Mass spectrometry identification of protein complexes

  • Bacterial Two-Hybrid Screening:

    • Systematic screening for interactions between mtgA and gliding motility proteins

    • Mapping interaction domains through truncation analyses

    • Validation of interactions by co-immunoprecipitation from C. hutchinsonii lysates

Advanced Imaging Approaches:

  • Super-Resolution Microscopy:

    • Localizing mtgA in relation to known components of the gliding apparatus

    • Tracking dynamic changes during initiation of motility

    • Correlating peptidoglycan synthesis with focal adhesion assembly/disassembly

  • Cryo-Electron Tomography:

    • Visualizing cell wall architecture at molecular resolution

    • Comparing wild-type and mtgA-depleted cells

    • 3D reconstruction of the gliding machinery in relation to peptidoglycan

These approaches can provide insights into how mtgA activity supports the specialized cell wall architecture needed for the unique form of gliding motility observed in C. hutchinsonii.

What insights can comparative studies between C. hutchinsonii mtgA and homologous proteins from the Bacteroidetes phylum provide about specialized cell wall adaptations?

Comparative studies of mtgA across the Bacteroidetes phylum can reveal evolutionary adaptations related to specialized niches and cellular functions:

Phylogenetic Analysis and Structural Comparison:

  • Sequence-Based Phylogeny:

    • Constructing phylogenetic trees of mtgA proteins across Bacteroidetes

    • Identifying clade-specific sequence signatures

    • Correlating sequence divergence with lifestyle (gliding vs. non-gliding)

  • Structural Homology Modeling:

    • Predicting structures of mtgA proteins from diverse Bacteroidetes

    • Mapping conservation onto structural models

    • Identifying structurally divergent regions that may relate to specialized functions

Functional Complementation Studies:

  • Cross-Species Complementation:

    • Expressing mtgA from diverse Bacteroidetes in C. hutchinsonii mtgA mutants

    • Assessing restoration of motility, cellulose degradation, and ion uptake

    • Identifying critical species-specific features

  • Domain Swapping Experiments:

    • Creating chimeric proteins combining domains from different Bacteroidetes mtgAs

    • Testing functionality in heterologous expression systems

    • Mapping domain-specific contributions to specialized functions

Comparative Biochemical Characterization:

  • Enzyme Kinetics:

    • Purifying recombinant mtgA from multiple Bacteroidetes species

    • Comparing substrate specificity and catalytic efficiency

    • Correlating biochemical properties with ecological niches

  • Product Analysis:

    • Analyzing peptidoglycan composition from diverse Bacteroidetes

    • Determining glycan chain length, cross-linking degree, and modifications

    • Correlating structure with specialized functions (gliding, substrate attachment)

Case Study: Comparison with Flavobacterium johnsoniae:
F. johnsoniae is another gliding member of the Bacteroidetes phylum with a well-characterized T9SS. Comparative analysis reveals:

  • Conservation of core catalytic residues in mtgA between both species

  • Differences in N-terminal transmembrane domains that may affect membrane localization

  • Variable regions that may interact with species-specific gliding machinery components

Such comparative studies can provide insights into how C. hutchinsonii mtgA has evolved specialized features supporting its unique ecological role in cellulose degradation and gliding motility, distinct from even closely related Bacteroidetes.

What are the experimental challenges in determining how mtgA activity is coordinated with the Type IX Secretion System (T9SS) and cellulose degradation machinery?

Investigating the coordination between mtgA, the T9SS, and cellulose degradation machinery presents several significant experimental challenges:

Technical Limitations:

  • Genetic Manipulation Difficulties:

    • C. hutchinsonii is challenging to transform efficiently

    • Limited selection markers available for multiple genetic modifications

    • Difficulty creating conditional mutants for essential genes

  • Protein Localization Challenges:

    • Fluorescent protein fusions may disrupt native protein function

    • Antibody generation for immunolocalization is resource-intensive

    • Resolution limitations in visualizing membrane protein complexes

  • Biochemical Isolation Complexities:

    • Difficulty preserving native protein-protein interactions during extraction

    • Challenges in solubilizing membrane protein complexes while maintaining functionality

    • Limited protein quantities from native expression systems

Methodological Approaches and Solutions:

  • Genetic System Enhancements:

    ChallengeInnovative Solution
    Limited transformation efficiencyOptimization of electroporation parameters with glycine treatment
    Few selectable markersDevelopment of markerless deletion systems using counterselection
    Difficulty creating conditional mutantsImplementation of CRISPRi or degradation tag systems
  • Advanced Localization Methods:

    ApproachAdvantageLimitation
    Split fluorescent protein complementationDetects protein interactions in vivoPotential false positives
    Proximity labeling (BioID, APEX)Maps protein neighborhoodsRequires genetic tagging
    Super-resolution microscopyAchieves nanoscale resolutionComplex sample preparation
  • Functional Coordination Analysis:

    TechniqueApplicationChallenge
    PhosphoproteomicsIdentifies regulatory eventsLimited sensitivity for membrane proteins
    Transcriptional reporter fusionsMaps co-regulation patternsMay not reflect post-transcriptional regulation
    Synchronized culture systemsTemporal coordination analysisDifficulty achieving synchronization

Research Design Considerations:

The elucidation of these coordination mechanisms will require innovative approaches that overcome these technical challenges, potentially leading to new methodological advances applicable to other complex bacterial systems.

What biotechnological applications might emerge from research on C. hutchinsonii mtgA and its coordination with cellulose degradation?

Research on C. hutchinsonii mtgA and its relationship to cellulose degradation has significant potential for novel biotechnological applications:

Biomass Conversion Technologies:

  • Enhanced Cellulolytic Systems:

    • Engineering cellulase complexes with improved substrate access by incorporating insights from C. hutchinsonii cell wall-cellulose interactions

    • Developing novel pretreatment processes based on understanding how peptidoglycan structure influences cellulose adhesion

    • Creating synthetic microbial consortia combining C. hutchinsonii cell wall elements with efficient cellulose degraders

  • Biofuel Production:

    • Improving consolidated bioprocessing organisms by incorporating C. hutchinsonii cell wall features

    • Engineering cell surface display systems based on mtgA-coordinated membrane organization

    • Developing immobilization technologies inspired by C. hutchinsonii's ability to adhere to cellulose

Pharmaceutical Applications:

  • Antimicrobial Development:

    • Identifying novel inhibitors targeting unique features of Bacteroidetes mtgA

    • Developing combination therapies targeting both peptidoglycan synthesis and T9SS

    • Creating screening platforms for cell wall-active compounds using recombinant mtgA

  • Drug Delivery Systems:

    • Engineered bacterial ghosts with modified peptidoglycan for controlled drug release

    • Cell surface display platforms based on understanding mtgA-dependent surface organization

    • Targeted delivery systems exploiting insights from cellulose-bacteria interactions

Materials Science Applications:

  • Biocomposite Development:

    • Creating cellulose-bacterial peptidoglycan composites with novel properties

    • Engineering living materials with programmable cellulose-degrading capabilities

    • Developing responsive biomaterials based on controlled peptidoglycan remodeling

  • Enzyme Immobilization Technologies:

    • Novel enzyme immobilization matrices based on modified peptidoglycan

    • Stable enzyme display platforms coordinating multiple cellulolytic activities

    • Patterned enzyme arrays inspired by C. hutchinsonii's cell surface organization

Environmental Remediation:

  • Cellulosic Waste Treatment:

    • Engineered biofilms with enhanced cellulose degradation capabilities

    • Bioremediation systems for cellulose-rich industrial waste

    • Immobilized enzyme systems with improved stability and reusability

The translation of fundamental research on mtgA and its coordination with cellulose degradation into these applications will require interdisciplinary collaboration between microbiologists, biochemists, materials scientists, and bioengineers.

How might systematic mutagenesis of recombinant mtgA help identify key residues involved in coordinating cell wall synthesis with gliding motility?

Systematic mutagenesis of recombinant mtgA can provide crucial insights into the coordination between cell wall synthesis and gliding motility through a structured approach:

Structure-Guided Mutagenesis Strategy:

  • Catalytic Site Mutations:

    • Targeting the conserved catalytic glutamate to create inactive variants

    • Engineering variants with altered catalytic efficiency

    • Creating substrate specificity mutants by modifying the binding pocket

  • Interface Mapping:

    • Alanine-scanning mutagenesis of surface-exposed residues

    • Charge-reversal mutations at potential protein-protein interaction sites

    • Cysteine substitutions for site-specific crosslinking studies

  • Domain-Focused Approaches:

    • Deletion analysis of non-catalytic domains

    • Insertion of flexible linkers between domains

    • Loop modification at predicted interaction interfaces

Functional Assessment Framework:

Mutation CategoryIn Vitro AnalysisCellular Phenotype Assessment
Catalytic siteEnzyme activity assays, product profile analysisGrowth rate, cell morphology, peptidoglycan composition
Putative interaction sitesProtein-protein interaction assays, stability analysisGliding motility rate, direction control, adhesion strength
Membrane associationMembrane binding assays, topology mappingProtein localization, cellular distribution patterns
Regulatory sitesPhosphorylation status, allosteric response assaysResponse to environmental signals, coordination with cell cycle

Advanced Screening Methodologies:

  • High-Throughput Mutant Library Screening:

    • Random mutagenesis libraries with phenotype-based selection

    • Deep sequencing to identify enriched or depleted variants

    • Correlation of mutation patterns with functional outcomes

  • Conditional Phenotype Analysis:

    • Temperature-sensitive mutants to identify conditional defects

    • Substrate-dependent phenotype analysis

    • Ion concentration-responsive variants

  • Combinatorial Mutation Approaches:

    • Identifying synthetic phenotypes through double mutants

    • Compensatory mutation analysis to map functional networks

    • Epistasis studies with T9SS component mutations

Integration with Structural Biology:

The mutagenesis data can be integrated with structural information to generate mechanistic models:

  • Mapping functional residues onto structural models

  • Molecular dynamics simulations of mutant proteins

  • Computational prediction of altered interaction networks

This systematic approach can reveal how specific residues in mtgA contribute to the coordination of peptidoglycan synthesis with gliding motility, potentially identifying key regulatory interfaces, mechanical coupling mechanisms, or signaling nodes that link these processes in C. hutchinsonii.

What experimental approaches could determine if mtgA plays a role in the ion homeostasis mechanisms linked to the T9SS in C. hutchinsonii?

Recent research has revealed an unexpected connection between the T9SS and ion homeostasis in C. hutchinsonii, particularly for Ca²⁺ and Mg²⁺ uptake. Determining whether mtgA plays a role in this process requires sophisticated experimental approaches:

Genetic and Phenotypic Analysis:

  • Controlled Expression Studies:

    • Creating conditional mtgA expression strains

    • Measuring intracellular ion concentrations at different expression levels

    • Correlating mtgA activity with ion uptake capacity

  • Epistasis Analysis:

    • Constructing double mutants of mtgA with known T9SS components

    • Testing genetic interactions with ion transport systems

    • Identifying suppressor mutations that restore ion homeostasis

  • Metal Sensitivity Profiling:

    • Conducting growth assays under varying metal ion concentrations

    • Testing metal chelator sensitivity of mtgA mutants

    • Measuring minimum inhibitory concentrations of various metal ions

Biochemical and Biophysical Approaches:

  • Metal Binding Analysis:

    • Isothermal titration calorimetry to measure direct metal binding

    • Differential scanning fluorimetry to assess metal-dependent stability

    • Electron paramagnetic resonance spectroscopy for metal coordination environment

  • Membrane Permeability Studies:

    • Measuring ion permeability in proteoliposomes containing recombinant mtgA

    • Fluorescent probe analysis of membrane potential in mtgA mutants

    • Tracking ion flux using radioisotopes or ion-selective electrodes

  • Structural Analysis:

    • Crystallographic studies with and without bound metal ions

    • Cryo-EM analysis of mtgA in membrane environments

    • NMR studies to identify metal-binding sites and conformational changes

Cellular Localization and Interaction Studies:

  • Co-localization Analysis:

    TechniqueApplicationOutput Measure
    Immunofluorescence microscopyLocalization of mtgA relative to ion transportersCorrelation coefficients
    FRET/BRET analysisDirect protein-protein interactionsEnergy transfer efficiency
    Fluorescence recovery after photobleachingMembrane dynamicsDiffusion coefficients
  • Protein Complex Analysis:

    • Blue native PAGE to identify native complexes containing mtgA

    • Mass spectrometry of crosslinked complexes

    • Co-immunoprecipitation with ion transport components

  • In Situ Structural Mapping:

    • Proximity labeling (BioID, APEX) to map protein neighborhoods

    • Chemical crosslinking mass spectrometry

    • Single-molecule localization microscopy of labeled components

Integrative Approaches:

  • Systems Biology Analysis:

    • Transcriptomic profiling comparing mtgA and T9SS mutants

    • Metabolomics analysis focusing on metal-dependent pathways

    • Network modeling to identify regulatory connections

  • Real-time Cellular Monitoring:

    • Live-cell imaging with fluorescent metal indicators

    • Correlation of peptidoglycan synthesis with ion uptake events

    • Single-cell analysis of ion content in relation to cell cycle and growth

These multifaceted approaches can determine whether mtgA plays a direct role in ion homeostasis, perhaps through effects on membrane organization, or if the observed relationships are indirect consequences of altered cell envelope integrity in mtgA mutants.

What are the key considerations for researchers planning to incorporate recombinant C. hutchinsonii mtgA into their experimental workflows?

Researchers incorporating recombinant C. hutchinsonii mtgA into their workflows should consider several practical aspects to ensure successful outcomes:

Protein Production and Quality Control:

  • Expression Optimization:

    • Codon optimization may be necessary for efficient expression in E. coli

    • Testing multiple expression conditions (temperature, inducer concentration, time)

    • Evaluating solubility enhancement strategies if aggregation occurs

  • Storage and Stability:

    • Optimal buffer composition: Tris-based buffer with 50% glycerol

    • Storage temperature: -20°C for short-term, -80°C for long-term stability

    • Avoiding repeated freeze-thaw cycles

    • Testing activity retention after storage periods

  • Quality Assessment:

    • Verifying protein purity by SDS-PAGE (target >90%)

    • Confirming identity by mass spectrometry

    • Assessing homogeneity by size exclusion chromatography

    • Validating activity with standardized enzymatic assays

Experimental Design Considerations:

  • Buffer and Reaction Conditions:

    • pH optimization: typically pH 7.0-8.0 for optimal activity

    • Divalent cation requirements: testing Mg²⁺, Mn²⁺, and Ca²⁺

    • Considering native growth conditions of C. hutchinsonii (30°C)

    • Detergent selection for membrane protein assays (e.g., 0.1% Triton X-100)

  • Control Experiments:

    • Including catalytically inactive mutants as negative controls

    • Using well-characterized transglycosylases as benchmarks

    • Incorporating appropriate substrate controls

    • Testing for E. coli contaminant activities

  • Scale and Throughput:

    • Miniaturization potential for high-throughput screening

    • Scale-up considerations for structural studies

    • Batch consistency checks for long-term projects

Integration with Other Experimental Systems:

  • Compatibility with Analytical Techniques:

    • HPLC detection methods for reaction products

    • Mass spectrometry parameters for glycan analysis

    • Fluorescence-based assay development

    • Surface plasmon resonance for interaction studies

  • Interdisciplinary Considerations:

    • Structural biology: Protein crystallization conditions

    • Biophysical studies: Sample requirements for various techniques

    • Cell biology: Delivery methods for functional complementation

    • Systems biology: Integration with -omics data

By carefully addressing these considerations, researchers can maximize the success of experiments involving recombinant C. hutchinsonii mtgA, ensuring that the protein behaves consistently and provides reliable results across different experimental contexts.

How should researchers interpret discrepancies between in vitro studies with recombinant mtgA and in vivo phenotypes in C. hutchinsonii?

Discrepancies between in vitro studies with recombinant mtgA and in vivo phenotypes in C. hutchinsonii are common and should be approached systematically:

Sources of Potential Discrepancies:

  • Protein-Related Factors:

    • Recombinant protein lacks native post-translational modifications

    • His-tag may interfere with protein interactions or localization

    • Altered folding in heterologous expression systems

    • Absence of native binding partners or regulatory factors

  • Environmental Differences:

    • Simplified in vitro conditions vs. complex cellular environment

    • Absence of cell envelope constraints on enzyme activity

    • Different ionic strength and crowding effects

    • Substrate accessibility differences

  • Methodological Limitations:

    • Detection sensitivity differences between systems

    • Temporal resolution of measurements

    • Spatial constraints in cellular context

    • Complex feedback mechanisms present only in vivo

Analytical Framework for Interpretation:

Discrepancy TypePotential CausesInvestigation Approach
Activity levels differRegulatory factors, cofactors, inhibitorsSupplementing in vitro reactions with cell extracts
Substrate specificity variesNative substrate modifications, accessibilityTesting expanded substrate panels, membrane mimetics
Phenotypic effects don't match biochemical predictionsRedundant pathways, compensatory mechanismsConstructing multiple mutants, stress testing
Localization affects functionMembrane microdomains, protein complexesMembrane reconstitution studies, in situ crosslinking

Bridging Strategies:

  • Intermediate Complexity Systems:

    • Cell-free expression systems incorporating native membranes

    • Spheroplast-based assays maintaining cellular organization

    • Liposome reconstitution with defined composition

    • Permeabilized cell assays preserving cellular architecture

  • Complementary Approaches:

    • Correlating in vitro biochemical parameters with in vivo phenotype severity

    • Using structure-guided mutagenesis to test mechanistic hypotheses

    • Developing biosensors to monitor activity in live cells

    • Creating minimal synthetic systems with increasing complexity

  • Computational Integration:

    • Predictive modeling incorporating both in vitro and in vivo data

    • Bayesian approaches to reconcile disparate datasets

    • Multi-scale modeling linking molecular and cellular levels

    • Sensitivity analysis to identify key parameters

Case Study Approach:
When encountering discrepancies, researchers should:

  • Document the specific nature and magnitude of the discrepancy

  • Generate multiple hypotheses to explain the observations

  • Design critical experiments to distinguish between hypotheses

  • Iterate between in vitro and in vivo systems with refined questions

By approaching discrepancies as opportunities for deeper investigation rather than experimental failures, researchers can develop more nuanced understandings of how mtgA functions within the complex cellular environment of C. hutchinsonii.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.