Recombinant Cytophaga hutchinsonii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
nuoA; CHU_1382; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
Target Names
nuoA
Target Protein Sequence
MNNKYAEYLPIAIQLMVTLGFISVTLLSSWLLGPKVKSKKKLDAFESGLDPVGNARVQFS IKYFLVATLFVLFDVEVIFFYPWAVNFNYFAEAVNKWEGFVKMLLFMTSLLIGFIYVIKK KALDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, the primary electron acceptor is believed to be menaquinone. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit A in Cytophaga hutchinsonii?

NADH-quinone oxidoreductase subunit A (nuoA) in C. hutchinsonii is a component of the NADH dehydrogenase complex (Complex I), which plays a crucial role in the electron transport chain and cellular respiration. Similar to its homologs in other bacteria, C. hutchinsonii nuoA likely contributes to energy metabolism by catalyzing the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane. This process is essential for ATP generation in this bacterium, which is known for its efficient cellulose degradation capabilities and gliding motility .

What are the optimal expression systems for producing recombinant C. hutchinsonii nuoA?

For the expression of recombinant C. hutchinsonii nuoA, several systems may be considered based on success with homologous proteins from other bacterial species:

  • E. coli Expression System: Most commonly used for initial attempts due to:

    • Rapid growth and high protein yields

    • Availability of numerous expression vectors and strains

    • Well-established protocols for membrane protein expression

  • Cell-Free Expression Systems: Particularly valuable for membrane proteins like nuoA when:

    • Toxicity is observed in host cells

    • Rapid screening of expression conditions is needed

    • Post-translational modifications can be controlled

  • Baculovirus Expression System: Provides eukaryotic processing capabilities while maintaining high yield potential:

    • More suitable for complex proteins requiring specific folding environments

    • Can accommodate larger proteins with multiple domains

    • Better for proteins that may be toxic to bacterial hosts

When selecting an expression system, researchers should consider the hydrophobic nature of nuoA as a membrane protein and potential toxicity issues. Expression in E. coli often requires optimization of reduced temperature (16-25°C), controlled induction conditions, and specialized strains designed for membrane protein expression.

What purification strategies are most effective for recombinant nuoA from C. hutchinsonii?

Purification of recombinant nuoA from C. hutchinsonii presents challenges typical of membrane proteins. An effective purification strategy typically involves:

  • Membrane Isolation and Solubilization:

    • Gentle cell lysis (e.g., French press or sonication with protease inhibitors)

    • Membrane fraction isolation through differential centrifugation

    • Solubilization using appropriate detergents (e.g., n-dodecyl-β-D-maltoside or digitonin)

  • Affinity Chromatography:

    • Histidine tag-based purification is common (Ni-NTA or TALON resins)

    • Washing buffers should maintain appropriate detergent concentrations above CMC

    • Use of imidazole gradients rather than step elution for better separation

  • Secondary Purification:

    • Size exclusion chromatography to achieve >85% purity

    • Ion exchange chromatography if additional purification is needed

Protein purity should be assessed via SDS-PAGE, with target purity of at least 85% for most biochemical and structural studies . Western blotting using antibodies against the affinity tag or nuoA itself can confirm protein identity.

For membrane proteins like nuoA, maintaining protein stability throughout purification is critical. Addition of glycerol (10-15%), specific lipids, and stabilizing agents in all buffers can significantly improve yield and activity of the purified protein.

How can researchers assess the functional activity of recombinant C. hutchinsonii nuoA?

Functional assessment of recombinant C. hutchinsonii nuoA requires both in vitro and in vivo approaches:

In vitro methods:

  • NADH Oxidation Assay: Measures the rate of NADH oxidation spectrophotometrically at 340 nm, typically with artificial electron acceptors like ferricyanide

  • Oxygen Consumption Measurements: Using oxygen electrodes to measure respiration rates in membrane preparations containing nuoA

  • Proton Translocation Assays: Using pH-sensitive dyes to detect proton movement across membranes

In vivo approaches:

  • Complementation Studies: Introduction of recombinant nuoA into deletion mutants to restore respiratory function

  • Growth Rate Analysis: Comparing growth kinetics in wild-type, nuoA-deletion, and complemented strains using techniques similar to those employed for SprA and SprT mutants

  • Metabolic Profiling: Assessing changes in metabolite levels resulting from nuoA mutation or overexpression

When evaluating functional activity, it's essential to consider the native environment of nuoA as part of a multicomponent complex. For more comprehensive analysis, researchers may need to co-express nuoA with other NADH dehydrogenase subunits to reconstruct a functional complex.

What techniques are most informative for structural characterization of nuoA from C. hutchinsonii?

Structural characterization of nuoA from C. hutchinsonii can be approached through multiple complementary techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Most suitable for membrane proteins like nuoA

    • Can resolve structures within the context of the entire NADH dehydrogenase complex

    • Requires highly pure protein preparations and specialized equipment

  • X-ray Crystallography:

    • Challenging for membrane proteins but provides high-resolution data

    • Often requires extensive screening of crystallization conditions

    • May benefit from use of antibody fragments or nanobodies to stabilize the protein

  • Nuclear Magnetic Resonance (NMR):

    • Limited to specific domains or fragments of nuoA due to size constraints

    • Provides valuable information about protein dynamics

    • Requires isotope labeling, typically with 13C and 15N

  • Computational Modeling:

    • Homology modeling based on structures of nuoA from other bacterial species

    • Molecular dynamics simulations to understand conformational changes

    • Protein-protein docking to predict interactions with other respiratory complex components

Combining these approaches with functional studies provides the most comprehensive understanding of nuoA structure-function relationships. Researchers should note that membrane proteins like nuoA often require specialized conditions throughout the structural determination workflow, including appropriate detergents, lipids, or nanodiscs to maintain native-like environments.

How does nuoA contribute to the unique cellulose degradation capabilities of C. hutchinsonii?

The relationship between nuoA and cellulose degradation in C. hutchinsonii is primarily indirect but critically important. As a component of the respiratory chain, nuoA contributes to energy generation that powers the cellulose degradation machinery:

  • Energy Supply for Secretion Systems: The T9SS in C. hutchinsonii, which is responsible for secreting cellulolytic enzymes to the cell surface, likely requires substantial energy input that depends on efficient respiratory chain function involving nuoA .

  • Bioenergetics for Gliding Motility: C. hutchinsonii's ability to glide along cellulose fibers during degradation requires energy that is generated through respiratory processes. Disruption of respiratory components can impair this motility, as seen with other protein deletions in C. hutchinsonii .

  • Metabolic Integration: Cellulose degradation and the subsequent metabolism of breakdown products require a functional respiratory chain for efficient ATP generation and redox balance maintenance.

While direct evidence linking nuoA specifically to cellulose degradation in C. hutchinsonii is limited, comparative studies with other respiratory chain components suggest that impairment of energy metabolism through nuoA deletion would likely affect the bacterium's cellulolytic capabilities. Studies with other T9SS components have demonstrated that mutations affecting secretion pathways result in defects in cellulose utilization and gliding motility .

What are the major technical challenges in studying C. hutchinsonii nuoA and how can they be overcome?

Researchers face several challenges when studying C. hutchinsonii nuoA:

  • Genetic Manipulation Difficulties:

    • C. hutchinsonii has historically been challenging to manipulate genetically

    • Solution: Use optimized deletion protocols with modified media containing supplemental Ca2+ and Mg2+, similar to approaches that proved successful for other genes like sprA and sprT

  • Membrane Protein Expression and Stability:

    • nuoA, as a membrane protein, poses inherent challenges for expression and purification

    • Solution: Employ specialized expression systems (cell-free expression systems or specialized bacterial strains) and optimize detergent screens for solubilization

  • Complex Functional Context:

    • nuoA functions as part of a multisubunit complex, making isolated functional studies difficult

    • Solution: Develop reconstitution systems using multiple subunits or study the protein in membrane vesicle preparations

  • Limited Direct References:

    • Sparse literature specifically addressing C. hutchinsonii nuoA

    • Solution: Leverage comparative genomics and knowledge from better-characterized homologs in other bacterial species

A particularly effective approach to overcome these challenges is to develop a comprehensive experimental pipeline that includes both in vivo and in vitro components, integrating genetic manipulation, biochemical characterization, and structural studies.

How does C. hutchinsonii nuoA compare structurally and functionally to homologs in other bacterial species?

Comparative analysis of C. hutchinsonii nuoA with its homologs in other bacterial species reveals important similarities and differences:

Bacterial SpeciesnuoA CharacteristicsExpression Systems UsedKey Functional Aspects
C. hutchinsoniiMembrane-embedded subunit of NADH dehydrogenaseLimited information availableLikely involved in energy metabolism supporting cellulose degradation
Pseudomonas aeruginosaWell-characterized nuoA (PA1883)E. coli, Cell-Free ExpressionComponent of respiratory complex I, important for virulence and biofilm formation
Geobacter speciesMultiple nuoA variants (nuoA1, nuoA-1, nuoA-2)E. coli, Cell-Free ExpressionCritical for extracellular electron transfer and metal reduction
Rhizobium melilotinuoA/nuoA1 identifiedE. coli, Cell-Free ExpressionImportant for symbiotic nitrogen fixation energy requirements

While all nuoA proteins share the fundamental role as components of NADH dehydrogenase complexes, the specific adaptations likely reflect the distinct ecological niches and metabolic requirements of each organism . For C. hutchinsonii, nuoA would be expected to support the energy-intensive processes of cellulose degradation and gliding motility that characterize this bacterium's lifestyle .

Structurally, all nuoA proteins are predicted to contain multiple transmembrane domains, but specific differences in these domains and connecting loops may contribute to species-specific interactions with other complex components or regulatory factors.

How can knowledge from T9SS studies inform research on nuoA and respiratory chain components in C. hutchinsonii?

The extensive research on the Type IX Secretion System (T9SS) in C. hutchinsonii provides valuable insights that can inform studies of nuoA and other respiratory chain components:

  • Methodological Approaches: Successful genetic manipulation techniques developed for T9SS components like SprA and SprT can be adapted for nuoA studies. These include:

    • Optimized screening media with Ca2+ and Mg2+ supplementation

    • Homologous recombination strategies for gene deletion

    • Complementation methods for phenotype verification

  • Phenotypic Analysis: The methodologies used to assess phenotypic changes in T9SS mutants provide a framework for evaluating respiratory chain mutants:

    • Cellulose utilization assays

    • Motility testing procedures

    • Ion uptake measurement techniques

  • Systems Integration: Understanding the interplay between T9SS and energy metabolism:

    • T9SS depends on energy provided by respiratory chain components like nuoA

    • Many T9SS substrates are enzymes involved in nutrient acquisition that feed into metabolic pathways linked to respiration

    • Both systems contribute to the distinctive ecological capabilities of C. hutchinsonii

While T9SS and respiratory chain components represent distinct cellular systems, the interconnected nature of these pathways in C. hutchinsonii suggests that integrative research approaches will yield the most comprehensive understanding of this bacterium's unique physiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.