Recombinant Dacnomys millardi Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Dacnomys millardi (Millard's rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMVPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI
Uniprot No.

Target Background

Function
Recombinant *Dacnomys millardi* Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation via three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) in subunit 1, composed of heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Dacnomys millardi Cytochrome c oxidase subunit 2 (MT-CO2)?

Recombinant Dacnomys millardi Cytochrome c oxidase subunit 2 (MT-CO2) is a laboratory-produced protein that replicates the naturally occurring subunit 2 of cytochrome c oxidase found in Millard's rat (Dacnomys millardi). This protein consists of 227 amino acids with a specific sequence beginning with MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISL and continuing through the full peptide chain . The protein functions as a component of the cytochrome c oxidase complex, which serves as the terminal enzyme in the mitochondrial electron transport chain. Commercially available recombinant preparations are typically supplied in a Tris-based buffer with 50% glycerol to maintain stability and are used primarily for research applications in cellular respiration, mitochondrial function, and comparative biology studies .

What is the functional role of Cytochrome c oxidase subunit 2 in cellular metabolism?

Cytochrome c oxidase subunit 2 serves as a critical component of the cytochrome c oxidase complex (Complex IV), which represents the final step in the mitochondrial electron transport chain that drives oxidative phosphorylation. This subunit plays an essential role in the catalytic mechanism that reduces molecular oxygen to water, contributing to the electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis . The respiratory chain contains three multisubunit complexes—succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV)—that cooperatively transfer electrons derived from NADH and succinate to molecular oxygen . MT-CO2 contains copper centers involved in electron transfer and forms part of the catalytic core of the enzyme complex, making it indispensable for cellular energy production through aerobic respiration.

How should researchers properly handle and store Recombinant Dacnomys millardi MT-CO2?

For optimal preservation of protein structure and function, Recombinant Dacnomys millardi MT-CO2 should be stored at -20°C for routine laboratory use, with long-term storage at -80°C to prevent degradation . The protein is typically supplied in a Tris-based buffer containing 50% glycerol that serves as a cryoprotectant . When working with this protein, researchers should avoid repeated freeze-thaw cycles as these can compromise protein integrity and biological activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . During experimental procedures, the protein should be handled on ice when possible and exposed to room temperature only when necessary. For applications requiring buffer exchange, gentle methods such as dialysis or size exclusion chromatography are recommended to prevent protein denaturation or aggregation.

What are the primary applications of Recombinant Dacnomys millardi MT-CO2 in research?

Recombinant Dacnomys millardi MT-CO2 serves numerous research applications across molecular biology, biochemistry, and comparative physiology. Primary applications include: (1) As a standard in enzyme-linked immunosorbent assays (ELISA) for detecting and quantifying MT-CO2 in biological samples ; (2) In studies investigating mitochondrial respiratory chain function and dysfunction; (3) For comparative analyses of cytochrome c oxidase structure and function across rodent species; (4) In research examining evolutionary conservation of respiratory chain components; and (5) As an immunogen for antibody production. The protein can also serve as a valuable tool in research examining cellular energetics during differentiation processes, as studies with related cytochrome c oxidase subunits have shown significant expression changes during cellular differentiation, such as T-cell development . Additionally, the protein provides a research model for investigating mitochondrial diseases associated with cytochrome c oxidase deficiencies.

How does the amino acid sequence of Dacnomys millardi MT-CO2 compare with other rodent species?

The amino acid sequence of Dacnomys millardi MT-CO2 (UniProt accession: Q38S14) displays both conserved functional domains and species-specific variations when compared to other rodent species . The 227-amino acid sequence contains critical functional regions that are highly conserved across rodents, particularly those forming the catalytic core and metal-binding sites. Sequence alignment analysis reveals:

SpeciesSequence Identity (%)Notable DifferencesConserved Functional Motifs
Dacnomys millardi100 (reference)-Copper-binding sites, transmembrane domains
Rattus norvegicus~90-95 (estimated)Minor variations in N-terminal regionAll catalytic residues conserved
Mus musculus~85-90 (estimated)Variations in transmembrane domainsConserved electron transfer pathways
Tatera robusta~75-85 (estimated)Greater divergence in loop regionsConserved metal coordination sites

The highest sequence conservation is observed in the functional copper-binding domains and regions involved in proton pumping, while greater variability occurs in peripheral regions. These sequence variations provide valuable insights into evolutionary adaptation while maintaining essential respiratory chain function. Researchers should consider these interspecies differences when designing cross-reactive antibodies or performing comparative functional studies.

What experimental protocols optimize the use of Recombinant Dacnomys millardi MT-CO2 in mitochondrial function studies?

For optimal results in mitochondrial function studies using Recombinant Dacnomys millardi MT-CO2, researchers should implement a multi-stage experimental approach:

  • Reconstitution Protocol: Recombinant MT-CO2 should be reconstituted into liposomes or nanodiscs containing cardiolipin and other mitochondrial membrane components to approximate the native environment. A typical formulation includes 70% phosphatidylcholine, 20% phosphatidylethanolamine, and 10% cardiolipin at a protein:lipid ratio of 1:100.

  • Functional Assessment: Oxygen consumption measurements using high-resolution respirometry provide the most sensitive quantification of cytochrome c oxidase activity. The standardized assay buffer should contain 50 mM potassium phosphate (pH 7.4), 50 μM cytochrome c, and 5 mM ascorbate with 0.5 mM TMPD (N,N,N′,N′-tetramethyl-p-phenylenediamine) as an electron donor.

  • Integration with Other Respiratory Complexes: To study interactions within the respiratory chain, Recombinant MT-CO2 can be incorporated into systems containing Complex III components, with activity monitored through spectrophotometric measurement of cytochrome c oxidation at 550 nm.

  • Inhibitor Studies: Comparative inhibition assays using azide, cyanide, and carbon monoxide provide insights into the catalytic mechanism and any structural differences from other mammalian cytochrome c oxidases.

These methodologies allow researchers to characterize both the intrinsic properties of Dacnomys millardi MT-CO2 and its functional interactions within the broader context of mitochondrial respiration.

How can researchers validate the activity of Recombinant Dacnomys millardi MT-CO2 in experimental settings?

Validation of Recombinant Dacnomys millardi MT-CO2 activity requires a multi-parameter approach to ensure biological relevance and experimental reliability:

  • Spectroscopic Validation: Functional MT-CO2 exhibits characteristic absorption peaks at 420 nm (Soret band) and 550-600 nm (α and β bands) when reduced. Researchers should confirm these spectral properties before proceeding with functional assays.

  • Polarographic Oxygen Consumption: Using a Clark-type oxygen electrode, researchers can quantify oxygen reduction catalyzed by the reconstituted protein complex. Active MT-CO2 should demonstrate oxygen consumption rates of 100-500 nmol O₂/min/mg protein when supplied with reduced cytochrome c.

  • Electron Transfer Kinetics: Stopped-flow spectroscopy measuring the rate of cytochrome c oxidation provides kinetic parameters (K₂ and Vₘₐₓ) that should align with published values for other mammalian cytochrome c oxidases (typical K₂ range: 5-20 μM).

  • Proton Pumping Efficiency: Using pH-sensitive fluorescent probes such as ACMA (9-amino-6-chloro-2-methoxyacridine) in proteoliposomes, researchers can confirm the proton translocation activity of functional MT-CO2, with an expected H⁺/e⁻ ratio of approximately 1.0.

  • Inhibitor Sensitivity Profile: Validation should include determination of IC₅₀ values for standard inhibitors (KCN: ~0.1-1 μM; sodium azide: ~10-50 μM) to confirm structural integrity of the catalytic site.

These validation approaches collectively provide comprehensive assessment of both structural integrity and functional capacity of the recombinant protein.

What techniques are most effective for studying MT-CO2 expression during cellular differentiation or stress conditions?

Investigating MT-CO2 expression dynamics during cellular differentiation or stress conditions requires sophisticated analytical approaches tailored to mitochondrial proteins:

  • Quantitative RT-PCR: For detecting changes in MT-CO2 mRNA levels, as observed in rat T-cell differentiation studies where expression levels were higher in early differentiation stages and decreased in mature T-cells . Primers should be designed to specifically amplify the MT-CO2 transcript with normalization to stable mitochondrial reference genes.

  • Mitochondrial Proteomics: Stable isotope labeling with amino acids in cell culture (SILAC) combined with high-resolution mass spectrometry enables quantitative tracking of MT-CO2 protein abundance changes. This approach can detect subtle alterations in protein levels with high sensitivity.

  • Immunocytochemistry with Confocal Microscopy: Co-localization studies using antibodies against MT-CO2 and differentiation markers can reveal spatial and temporal patterns of expression during cellular development.

  • Blue Native PAGE: This technique preserves protein complexes in their native state, allowing assessment of MT-CO2 incorporation into fully assembled cytochrome c oxidase during different cellular states.

  • Respirometry Combined with Cell Sorting: Flow cytometry-based cell sorting followed by high-resolution respirometry allows correlation of MT-CO2 expression levels with functional respiratory capacity at specific differentiation stages.

These methodologies have revealed that mitochondrial protein expression, including cytochrome c oxidase subunits, can serve as markers for cellular differentiation status and metabolic adaptation to stress conditions .

How can Recombinant Dacnomys millardi MT-CO2 be integrated into complex in vitro models of mitochondrial diseases?

Integrating Recombinant Dacnomys millardi MT-CO2 into complex in vitro models of mitochondrial diseases requires sophisticated experimental designs that recapitulate disease-relevant conditions:

  • Complementation Studies in Patient-Derived Cells: Recombinant MT-CO2 can be introduced into fibroblasts or cybrid cells from patients with MT-CO2 mutations using specialized protein delivery systems such as lipid-based transfection reagents or electroporation. Rescue of respiratory function, as measured by oxygen consumption rate (OCR) and extracellular acidification rate (ECAR), indicates functional complementation.

  • 3D Organoid Models: Incorporating the recombinant protein into cerebral or cardiac organoids generated from induced pluripotent stem cells (iPSCs) allows assessment of MT-CO2 function in tissue-specific contexts relevant to mitochondrial encephalomyopathies or cardiomyopathies.

  • Microfluidic "Organ-on-a-Chip" Systems: These platforms enable real-time monitoring of metabolic parameters in the presence of wild-type or mutant MT-CO2 variants, particularly valuable for modeling mitochondrial diseases with tissue-specific manifestations.

  • CRISPR-Based Disease Modeling: Engineered cell lines with precise mutations in MT-CO2 can be complemented with the recombinant protein to establish genotype-phenotype correlations and test therapeutic strategies.

  • Biomimetic Matrices: Incorporating the recombinant protein into biomimetic scaffolds that replicate the physical properties of tissues affected by mitochondrial diseases allows for more physiologically relevant studies of protein function and therapeutic interventions.

This integrated approach facilitates development of targeted therapeutic strategies for mitochondrial diseases involving cytochrome c oxidase dysfunction, which represent some of the most severe mitochondrial disorders with limited treatment options.

What controls should be included when designing experiments with Recombinant Dacnomys millardi MT-CO2?

Robust experimental design with Recombinant Dacnomys millardi MT-CO2 requires comprehensive controls to ensure data validity and interpretability:

  • Positive Functional Controls: Include commercially available bovine heart cytochrome c oxidase as a reference standard for activity assays, with expected activity values established for your experimental system.

  • Negative Controls for Specificity:

    • Heat-inactivated MT-CO2 (95°C for 10 minutes) to confirm that observed effects are due to the active protein

    • Irrelevant recombinant proteins of similar size and preparation method to rule out non-specific effects

    • Buffer-only controls containing all components except the recombinant protein

  • Antibody Validation Controls:

    • Pre-adsorption controls when using anti-MT-CO2 antibodies

    • Secondary antibody-only controls to assess non-specific binding

    • Cross-reactivity tests with related species' MT-CO2 proteins

  • System-Specific Controls:

    • For reconstitution experiments: protein-free liposomes to establish baseline membrane properties

    • For cell-based assays: cytochrome c oxidase inhibitors (e.g., potassium cyanide) to confirm specific activity

    • For respiratory chain studies: rotenone and antimycin A to inhibit upstream complexes

  • Stability Controls:

    • Time-course activity measurements to monitor protein stability under experimental conditions

    • Storage condition comparisons (4°C, -20°C, -80°C) to establish optimal handling protocols

These comprehensive controls help distinguish specific biological effects from artifacts and provide benchmarks for interpreting experimental results across different studies.

How can researchers troubleshoot common challenges when working with Recombinant Dacnomys millardi MT-CO2?

Researchers working with Recombinant Dacnomys millardi MT-CO2 may encounter several technical challenges that can be addressed through systematic troubleshooting approaches:

ChallengePossible CausesTroubleshooting Strategies
Low enzymatic activityProtein denaturation, improper storage, copper loss- Supplement with Cu²⁺ (5-10 μM CuSO₄)
- Verify pH of reaction buffer (optimal: pH 7.2-7.4)
- Check reducing agent concentration (excess can inhibit)
Aggregation during reconstitutionInappropriate lipid composition, high protein concentration- Optimize protein:lipid ratio (start with 1:100)
- Include cardiolipin (10-20%) in lipid mixture
- Use gradual detergent removal via Bio-Beads SM-2
Poor antibody recognitionEpitope masking, species cross-reactivity issues- Try multiple antibodies targeting different epitopes
- Perform mild denaturation to expose hidden epitopes
- Validate antibodies with positive control samples
Inconsistent activity measurementsTemperature fluctuations, substrate limitations- Maintain strict temperature control (25°C ± 0.1°C)
- Ensure excess cytochrome c (>50 μM)
- Use internal standards to normalize between experiments
Rapid activity lossOxidative damage, proteolytic degradation- Add antioxidants (1 mM ascorbate, 20 μg/ml catalase)
- Include protease inhibitor cocktail
- Store in single-use aliquots

When encountering persistent issues, researchers should consider protein quality assessment via circular dichroism spectroscopy to evaluate secondary structure integrity, and mass spectrometry to verify protein sequence and potential post-translational modifications that might affect function.

What are the most sensitive analytical methods for detecting and quantifying MT-CO2 in complex biological samples?

Detection and quantification of MT-CO2 in complex biological samples requires highly sensitive and specific analytical methods:

  • Targeted Proteomics via Multiple Reaction Monitoring (MRM): This mass spectrometry approach can detect MT-CO2 with sensitivity in the femtomole range using isotopically labeled peptide standards. Specific MRM transitions for unique MT-CO2 peptides include:

    • LLETDNR: 437.2 → 632.3, 519.2, 418.2

    • VVLPIEAPIR: 540.3 → 684.4, 797.5, 571.3

  • Proximity Ligation Assay (PLA): This technique can detect MT-CO2 in tissue sections with single-molecule sensitivity by using pairs of antibodies against different epitopes of MT-CO2, providing spatial information that conventional immunoassays cannot achieve.

  • Enzyme-Linked Immunosorbent Assay (ELISA): Sandwich ELISA using monoclonal capture antibodies and polyclonal detection antibodies can achieve detection limits of 0.1-1 ng/ml in tissue homogenates and cell lysates .

  • Immunocapture Combined with Activity Assay: This approach allows selective isolation of MT-CO2-containing complexes from biological samples followed by spectrophotometric activity measurement, providing both quantitative and functional information.

  • Digital PCR for mtDNA-Encoded MT-CO2: For transcriptional analysis, this method provides absolute quantification of MT-CO2 mRNA with higher precision than conventional qPCR for samples with low abundance transcripts.

Selection of the appropriate method depends on the specific research question, sample type, and whether protein abundance, localization, or functional activity is the primary parameter of interest.

How can Recombinant Dacnomys millardi MT-CO2 be effectively labeled for imaging studies?

For effective visualization in imaging studies, Recombinant Dacnomys millardi MT-CO2 can be labeled using several strategies optimized for mitochondrial proteins:

  • Site-Specific Fluorescent Labeling:

    • Introduce a single cysteine residue at a non-functional site through site-directed mutagenesis

    • Label with maleimide-conjugated fluorophores (Alexa Fluor 488, 555, or 647)

    • Optimal labeling conditions: pH 7.2, 4°C, overnight in the presence of 1 mM TCEP as reducing agent

  • Enzyme-Mediated Labeling:

    • Engineer the protein with a C-terminal LPETG motif for sortase-mediated transpeptidation

    • React with glycine-conjugated fluorophores or biotin for versatile detection

    • This approach maintains native protein structure with minimal interference

  • Click Chemistry-Based Labeling:

    • Incorporate azidohomoalanine during recombinant expression

    • Label via copper-catalyzed or strain-promoted azide-alkyne cycloaddition

    • Compatible with various imaging modalities including super-resolution microscopy

  • Quantum Dot Conjugation for Long-Term Imaging:

    • Conjugate quantum dots to antibodies against MT-CO2

    • Provides photostable signal for extended live-cell imaging

    • Particularly valuable for tracking mitochondrial dynamics

  • Split Fluorescent Protein Complementation:

    • Fuse MT-CO2 with one fragment of a split fluorescent protein (e.g., GFP1-10)

    • Co-express with the complementary fragment (GFP11) fused to an interaction partner

    • Enables visualization of protein-protein interactions in living cells

These approaches enable visualization of MT-CO2 localization, dynamics, and interactions within the native cellular environment, providing insights into both normal function and disease-related alterations in mitochondrial organization.

What bioinformatic tools and resources are most valuable for analyzing MT-CO2 sequence, structure, and function?

Researchers investigating MT-CO2 can leverage several specialized bioinformatic tools and resources for comprehensive analysis:

  • Sequence Analysis Tools:

    • MitoProtII: Predicts mitochondrial targeting sequences and cleavage sites

    • TMHMM/TOPCONS: Identifies transmembrane domains within MT-CO2 sequence

    • ConSurf: Maps evolutionary conservation onto protein sequence

    • MitoCarta3.0: Comprehensive inventory of mitochondrial proteins for comparative analysis

  • Structural Biology Resources:

    • PDB entries of cytochrome c oxidase complexes (e.g., 1OCC, 2OCC)

    • AlphaFold Database: Contains predicted structures for MT-CO2 from various species

    • SWISS-MODEL: For homology modeling of specific Dacnomys millardi MT-CO2

    • PyMOL scripts for visualizing copper coordination sites and electron transfer pathways

  • Functional Analysis Resources:

    • KEGG Pathway Database: Maps MT-CO2 in the context of oxidative phosphorylation

    • STRING Database: Visualizes protein-protein interaction networks

    • MitoMiner: Integrates proteomic datasets for mitochondrial proteins

    • MITOMAP: Repository of mitochondrial DNA variations including MT-CO2 mutations

  • Evolutionary Analysis Tools:

    • PAML: For detecting positive selection in MT-CO2 across species

    • MitoPhAST: Phylogenetic analysis specifically optimized for mitochondrial genes

    • SNiPA: Identifies single nucleotide polymorphisms in MT-CO2 across populations

  • Systems Biology Resources:

    • Virtual Cell: For modeling MT-CO2 in the context of respiratory chain kinetics

    • Cell Collective: Platform for collaborative modeling of mitochondrial pathways

    • MetaCyc/BioCyc: Metabolic pathway databases with extensive annotation

These computational resources enable integration of experimental data with predictive models, facilitating hypothesis generation and experimental design for complex questions regarding MT-CO2 structure, function, and evolution across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.