Recombinant Dama dama Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Dama dama Melanocyte-Stimulating Hormone Receptor (MC1R) is a laboratory-engineered version of the MC1R protein derived from the fallow deer (Dama dama). This receptor is a G protein-coupled receptor (GPCR) critical for regulating melanin production in melanocytes. It binds α-melanocyte-stimulating hormone (α-MSH) to activate cAMP signaling, promoting eumelanin synthesis (protective dark pigment) over pheomelanin (red/yellow pigment) .

Key Domains and Sequence

MC1R is a seven-pass transmembrane receptor with:

  • N-terminal glycosylation site (critical for ligand binding) .

  • DRY motif at the junction of the third transmembrane domain (essential for G protein coupling) .

  • C-terminal palmitoylation site (regulates receptor trafficking) .

The full-length recombinant protein (317 amino acids) includes a His-tag for purification and retains functional domains for ligand binding and signal transduction .

Expression Systems

PropertyDetails
Host SystemE. coli
TagN-terminal His-tag
Purity≥85–90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Validation

  • Binds α-MSH and agouti signaling protein (ASIP) .

  • Retains cAMP activation capacity in vitro .

Key Studies Using Recombinant MC1R

  1. Coat Color Genetics: Identified MC1R mutations (e.g., c.143 T>C leading to p.L48P) responsible for white coat phenotypes in fallow deer .

  2. Functional Assays: Demonstrated impaired cAMP signaling in mutants, correlating with reduced eumelanin synthesis .

  3. Structural Analysis: Characterized disulfide bonds (e.g., C35, C267) critical for receptor dimerization and trafficking .

Notable Variants in Fallow Deer

MutationEffect on MC1RPhenotypic Outcome
p.L48PDisrupts transmembrane helix structureWhite coat color
C35SBlocks receptor dimerizationLoss of membrane trafficking

MC1R Across Species

SpeciesKey MC1R FeaturesReference
HumanRHC variants (e.g., R151C) linked to melanoma risk
Fallow DeerL48P mutation causes coat color dilution
MouseConstitutive activation increases eumelanin

Challenges and Future Directions

  • Limitations: Recombinant MC1R may lack post-translational modifications present in vivo .

  • Opportunities: Use in high-throughput drug screening for melanogenesis modulators or melanoma therapies .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference for your preparations.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MC1R; MSHR; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Dama dama (Fallow deer) (Cervus dama)
Target Names
Target Protein Sequence
MPVLGSQRRLLGSLNCTPPATFPLTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAMSDLLVSVSNVLETAVMLLLEAGALAAQAAVVQQLDNVI DVLICGSMVSSLCFLGAIAVDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFI TYYNHTVVLLCLVGFFIAMLALMAVLYVHMLARACQHARGIARLQKRQRPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW
Uniprot No.

Target Background

Function
The melanocyte-stimulating hormone receptor 1 (MC1R) is a G protein-coupled receptor for α-, β-, and γ-MSH and ACTH. Its activation stimulates adenylate cyclase, mediating melanogenesis—the production of eumelanin (black/brown) and pheomelanin (red/yellow) pigments—through cAMP signaling regulation in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of MC1R in Dama dama and how does it compare to other mammalian species?

MC1R in Dama dama, like in other mammals, functions as a seven-pass transmembrane G protein-coupled receptor (GPCR) composed of an N-terminal domain, seven hydrophobic transmembrane domains, and a carboxy terminal domain . The protein is primarily expressed on the surface of melanocytes.

The MC1R gene in fallow deer contains a coding sequence with notable homology to other species but with specific variants unique to Dama dama. The p.L48P substitution located within the first transmembrane motif appears to be particularly significant in fallow deer, resulting in coat color variation . This position is structurally critical, as leucine is typically found with above-average frequency in helix structures and rarely substituted by other amino acids, indicating its important structural function .

When designing recombinant expression studies, researchers should note the differences in amino acid sequence and post-translational modifications between deer MC1R and other mammalian homologs, particularly in regions involved in ligand binding and G-protein coupling.

What genetic variants of MC1R have been identified in Dama dama and what are their phenotypic effects?

A key variant identified in Dama dama is the c.143 T > C nucleotide substitution, resulting in a leucine to proline amino acid exchange at position 48 (p.L48P) of the MC1R receptor protein . This mutation has profound effects on coat color:

GenotypePhenotypeFrequency in Study Population
CCWhite coat (pale beige dilution)100% of white animals
TT or TCPigmented (brown or dark)100% of pigmented animals
TC (heterozygous)Pigmented but carrier of white allele14% of pigmented animals

This variant does not cause complete albinism but rather a very pale beige dilution of coat color, with the eyes and claws remaining pigmented . The p.L48P substitution likely affects protein function because proline, with its rigid structure, is a well-known breaker of secondary structures, potentially altering the gross secondary structure from α-helix to β-sheet-like configuration in the transmembrane domain .

What are the recommended methods for isolating and sequencing MC1R from Dama dama tissue samples?

For optimal isolation and sequencing of MC1R from fallow deer tissue samples:

  • Sample collection: Obtain tissue samples (ideally skin biopsies containing melanocytes) or blood samples from individuals. Preserve in RNAlater or flash-freeze in liquid nitrogen.

  • Nucleic acid extraction:

    • For genomic DNA: Use commercial kits optimized for mammalian tissue (e.g., DNeasy Blood & Tissue Kit)

    • For RNA: Extract using Trizol reagent followed by cDNA synthesis using reverse transcriptase

  • Cloning and sequencing: Clone PCR products into appropriate vectors for sequencing or perform direct sequencing depending on the research requirements. For comprehensive analysis, consider next-generation sequencing approaches as employed in previous studies of fallow deer MC1R variants .

When analyzing sequence data, pay particular attention to position 143 (c.143 T > C) which contains the known variant associated with coat color dilution in this species.

What expression systems are optimal for producing functional recombinant Dama dama MC1R?

For producing functional recombinant Dama dama MC1R, consider the following expression systems and methodological approaches:

  • Mammalian expression systems (recommended for functional studies):

    • HEK293 cells provide appropriate post-translational modifications

    • Melanocyte cell lines (e.g., B16 mouse melanoma cells) offer a physiologically relevant background

    • Use expression vectors with strong promoters (CMV) and appropriate tags (HA, FLAG, or His-tag) for detection and purification

  • Insect cell expression systems:

    • Sf9 or High Five insect cells with baculovirus vectors

    • Beneficial for membrane proteins like MC1R that may be toxic to mammalian cells at high expression levels

  • Cell-free systems:

    • Useful for initial structural studies

    • Consider adding lipid nanodiscs or detergents to stabilize the transmembrane domains

When expressing MC1R variants, include wild-type controls and known functional variants for comparison. The p.L48P variant is of particular interest as it occurs in the first transmembrane domain where several other functional variants have been described in humans (V38M, S41F, V51A) . These human variants result in reduced cell surface expression due to retention in the endoplasmic reticulum and/or decreased coupling to adenylate cyclase .

Validate expression using Western blotting, immunofluorescence for localization, and functional assays measuring cAMP production in response to α-MSH stimulation.

How can researchers assess the functional consequences of the p.L48P mutation on MC1R signaling?

To assess the functional impact of the p.L48P mutation on MC1R signaling, implement a multi-level experimental approach:

  • Structural analysis:

    • Use protein modeling software to predict structural changes

    • Consider how proline might disrupt the α-helix structure of the first transmembrane domain

    • Compare with known disruptive mutations in similar membrane-bound proteins

  • Cell surface expression assays:

    • Transfect cells with wild-type and mutant MC1R constructs

    • Use flow cytometry with surface-specific antibodies

    • Perform biotinylation assays to quantify surface expression

    • Utilize confocal microscopy to assess localization (plasma membrane vs. intracellular retention)

  • Signaling pathway analysis:

    • Measure cAMP production using ELISA or reporter systems

    • Assess adenylate cyclase coupling efficiency

    • Examine downstream effects on MITF activation and eumelanin production

    • Quantify calcium signaling as a secondary pathway

  • Ligand binding studies:

    • Use radiolabeled or fluorescent α-MSH to measure binding affinity

    • Perform competition assays with ASIP (agouti signaling protein)

    • Assess how the p.L48P mutation affects binding kinetics

  • Palmitoylation analysis:

    • Investigate whether the mutation affects palmitoylation of MC1R

    • Use inhibitors like 2-bromopalmitic acid (2-BrP) to assess palmitoylation dependence

    • Perform metabolic labeling with palmitate analogs

The p.L48P mutation likely reduces MC1R function by altering protein structure, as proline is known to bend the main chain of proteins and break secondary structures . Compare results with studies of human MC1R variants to identify conserved mechanisms.

What methods are available for studying MC1R-mediated protection against UV radiation damage?

MC1R plays a crucial role in protecting melanocytes from UV radiation damage, particularly regarding chromosome stability and centromeric integrity. Researchers can employ the following methodological approaches:

  • Chromosome stability assessment:

    • Giemsa staining and metaphase spread chromosome analysis in melanocytes after UV exposure

    • Telomere and centromeric fluorescence in situ hybridization (FISH) to detect specific chromosome aberrations

    • Analysis of lagging chromosomes and anaphase bridges during cell division

  • Experimental design for UV studies:

    • Use human primary melanocytes or established melanocyte cell lines expressing wild-type or mutant MC1R

    • Pre-treat cells with α-MSH (10 μM) before irradiation with UVB (typical dose: 100 J/m²)

    • Include appropriate controls: MC1R-silenced cells, palmitoylation inhibition with 2-BrP (50 μM)

  • DNA damage assessment:

    • Comet assay to detect DNA strand breaks

    • Immunofluorescent staining for phosphorylated H2AX (γH2AX) foci

    • Measurement of cyclobutane pyrimidine dimers (CPDs) and 6-4 photoproducts

  • Signaling pathway analysis:

    • Assess MITF expression and activation as MITF is critical for α-MSH/MC1R-controlled chromosome stability

    • Evaluate MITF interaction with centromere protein A using co-immunoprecipitation

    • Measure cAMP levels in response to UV and α-MSH stimulation

Experimental ConditionChromosome AberrationsCentromeric FragmentationsAnaphase Bridges
Control MelanocytesLowLowRare
UVB-treatedModerateModerateOccasional
MC1R-silenced + UVBHighHighFrequent
α-MSH pre-treatment + UVBLowLowRare
α-MSH + 2-BrP + UVBHighHighFrequent

These methodologies enable researchers to characterize the protective role of MC1R signaling against UV-induced genomic instability in melanocytes and could be applied to study recombinant Dama dama MC1R variants .

How can CRISPR-Cas9 gene editing be utilized to study MC1R function in cellular models?

CRISPR-Cas9 technology offers powerful approaches for studying MC1R function through precise genetic manipulation:

  • Knockout strategies:

    • Design guide RNAs targeting conserved regions of MC1R

    • Create complete knockout cell lines to study loss-of-function phenotypes

    • Generate heterozygous knockouts to study dosage effects

    • Validate knockouts through sequencing, Western blotting, and functional assays

  • Knockin approaches for studying specific variants:

    • Introduce the p.L48P mutation found in white fallow deer into melanocyte cell lines

    • Create cell lines with multiple variants to study epistatic interactions

    • Use homology-directed repair with donor templates containing the desired mutations

    • Implement base editing for precise nucleotide substitutions without double-strand breaks

  • Regulatory element manipulation:

    • Target enhancers and promoters controlling MC1R expression

    • Employ CRISPRi (CRISPR interference) to repress MC1R expression

    • Use CRISPRa (CRISPR activation) to upregulate MC1R expression

  • Reporter systems:

    • Knock in fluorescent proteins to track MC1R expression

    • Create split-GFP systems to visualize protein-protein interactions

    • Develop luciferase reporters for pathway activation

  • Experimental validation protocols:

    • Design appropriate controls including non-targeting gRNAs and wild-type cell lines

    • Perform clonal isolation and expansion

    • Validate edits through deep sequencing

    • Assess off-target effects using whole-genome sequencing or targeted approaches

This approach would allow direct comparison between wild-type MC1R and variants like p.L48P in an identical genetic background, providing insights into how specific mutations affect receptor function, signaling, and phenotypic outcomes such as pigmentation and UV protection.

What role does protein palmitoylation play in MC1R function and how can it be studied in the context of the Dama dama receptor?

Palmitoylation of MC1R is essential for activating MC1R signaling and plays a critical role in the receptor's ability to protect against UV-induced chromosome instability. To study this post-translational modification in Dama dama MC1R:

  • Identification of palmitoylation sites:

    • Perform site-directed mutagenesis of cysteine residues in MC1R

    • Use mass spectrometry to identify palmitoylated peptides

    • Apply predictive algorithms to identify potential palmitoylation sites in the Dama dama sequence

  • Palmitoylation inhibition studies:

    • Treat cells expressing recombinant MC1R with 2-bromopalmitic acid (2-BrP, 50 μM), a general palmitoylation inhibitor

    • Assess effects on receptor localization, signaling, and protective functions

    • Compare effects on wild-type vs. p.L48P variant

  • Metabolic labeling:

    • Use click chemistry with alkyne-modified palmitate analogs

    • Perform pulse-chase experiments to determine palmitoylation dynamics

    • Quantify palmitoylation levels under different conditions (basal, α-MSH stimulation, UV exposure)

  • Functional consequences assessment:

    • Examine how palmitoylation affects:

      • Cell surface expression and receptor internalization

      • Coupling to G proteins and adenylate cyclase

      • cAMP production in response to α-MSH

      • Protection against UV-induced chromosome aberrations

Research has shown that MC1R signaling-regulated chromosome stability and centromeric integrity are palmitoylation-dependent in melanocytes . When human primary melanocytes were stimulated with α-MSH and treated with 2-BrP before UVB irradiation, strong cytogenetic alterations were detected, indicating that palmitoylation is necessary for MC1R's protective functions .

Determining whether the p.L48P mutation in Dama dama MC1R affects palmitoylation efficiency would provide insights into the mechanism by which this variant influences coat color.

How does MC1R signaling interact with MITF to regulate chromosome stability and centromere integrity?

The relationship between MC1R signaling and MITF (microphthalmia-associated transcription factor) in maintaining chromosome stability represents an advanced area of research with significant implications:

  • Mechanistic studies of the MC1R-MITF axis:

    • Investigate how α-MSH/MC1R signaling activates MITF in melanocytes

    • Examine MITF phosphorylation status following MC1R activation

    • Analyze transcriptional changes of MITF target genes after MC1R stimulation

  • MITF interaction with centromere proteins:

    • Perform chromatin immunoprecipitation (ChIP) to identify MITF binding at centromeric regions

    • Use co-immunoprecipitation to examine direct interactions between MITF and centromere protein A

    • Employ proximity ligation assays to visualize MITF-centromere protein interactions in situ

  • Experimental manipulation of the pathway:

    • Generate MITF knockdown and overexpression in melanocytes with wild-type or variant MC1R

    • Assess chromosome stability using the following experimental design:

Experimental ConditionUV ExposureExpected Chromosome Instability
Control melanocytes-Low
Control melanocytes+Moderate
MC1R-silenced-Low
MC1R-silenced+High
MC1R-silenced + α-MSH+High (no rescue)
MC1R-silenced + MITF overexpression+Low (rescue)
MITF-silenced-Moderate
MITF-silenced + α-MSH+High (no rescue)
  • Centromere integrity assessment:

    • Perform FISH analysis focusing on centromeric regions

    • Quantify centromeric fragmentations under various conditions

    • Analyze kinetochore assembly and function during mitosis

Research has demonstrated that MC1R silencing augments UVR-induced chromosome instability, and MITF silencing prevents the protective effect of α-MSH stimulation. Importantly, MITF overexpression can rescue UVR-induced cytogenetic alterations in melanocytes with MC1R silencing . These findings suggest that MITF is a required mediator in α-MSH/MC1R-controlled chromosome stability.

What structural biology approaches can elucidate the conformational changes induced by the p.L48P mutation in Dama dama MC1R?

Advanced structural biology techniques can provide crucial insights into how the p.L48P mutation affects MC1R structure and function:

  • Computational structural modeling:

    • Perform homology modeling based on related GPCR crystal structures

    • Use molecular dynamics simulations to analyze conformational changes

    • Compare wild-type and p.L48P variant trajectories to identify structural perturbations

    • Analyze how proline might disrupt the α-helix of the first transmembrane domain

  • X-ray crystallography and cryo-EM approaches:

    • Express and purify recombinant wild-type and p.L48P MC1R

    • Stabilize using appropriate detergents or lipid nanodiscs

    • Attempt crystallization with and without bound α-MSH

    • Use single-particle cryo-EM for structural determination if crystallization proves challenging

  • Spectroscopic methods:

    • Circular dichroism (CD) spectroscopy to assess secondary structure changes

    • Nuclear magnetic resonance (NMR) for dynamic structural information

    • Fourier-transform infrared spectroscopy (FTIR) to analyze protein folding

  • Biophysical characterization:

    • Thermal stability assays to measure protein stability

    • Surface plasmon resonance (SPR) to quantify ligand binding kinetics

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

  • Structure-function relationship studies:

    • Create series of point mutations around position 48

    • Test conservative substitutions (L48A, L48I) versus disruptive ones (L48P)

    • Correlate structural predictions with functional outcomes

The p.L48P substitution is particularly interesting because it introduces proline, which is known to bend protein backbones and break secondary structures . This substitution is located within the helix structure of the first transmembrane motif, where several other non-synonymous variants have been described in humans with functional consequences . The introduction of proline at this position could alter the gross secondary structure from α-helix to β-sheet-like, which would be detrimental to receptor function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.