Recombinant Danio rerio Abhydrolase domain-containing protein 13 (abhd13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
abhd13; zgc:123286; Protein ABHD13; Alpha/beta hydrolase domain-containing protein 13; Abhydrolase domain-containing protein 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
abhd13
Target Protein Sequence
MEKPWRLWGPLEACLLSVCAWSWGFCRVSLLALILTFHLYGGFVLLGLILASLAGILYKF QDVLLYFPDQPSSSRLYVPMPTGIPHENVYIRTKDGIRLNLILLRYTGENPAGAPTILYF HGNAGNIGHRVPNALLMLVNLKANVVLVDYRGYGKSEGDPSEDGLYQDAEATLDYVMTRP DIDKTKVVLFGRSLGGAVAIRLASCNPHRVAAIMVENTFLSIPHMAATLFSFFPMRYLPL WCYKNKFLSYRHVVPCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPEGTHND TWQCQGYFSALEQFMKELLKSHAREETTQGTASVTII
Uniprot No.

Target Background

Database Links
Protein Families
Serine esterase family
Subcellular Location
Membrane; Single-pass type II membrane protein.

Q&A

What are the predicted structural features and functional domains of zebrafish abhd13?

Zebrafish abhd13 contains several key structural features characteristic of the ABHD family:

  • Alpha/Beta hydrolase fold: The core structural element that defines this protein family

  • Alpha/beta hydrolase fold-1: A specific subtype of this structural motif

  • Catalytic triad: Like other ABHD proteins, abhd13 is predicted to contain a nucleophile-acid-histidine catalytic triad typical of hydrolases

  • Membrane association domains: Hydrophobic regions that facilitate its predicted membrane localization

Based on domain analysis, abhd13 likely contains:

DomainPositionFunction
Alpha/Beta hydrolase foldCentral regionCore catalytic domain
Transmembrane regionsN-terminalMembrane anchoring
Catalytic siteWithin hydrolase foldEnzymatic activity

The protein shares domain architecture with other ABHD family members, though it possesses unique features that differentiate it from other hydrolases such as ABHD6 or ABHD12 .

How is the zebrafish abhd13 gene organized and regulated?

The zebrafish abhd13 gene is located on chromosome 9 and was previously known by the alias zgc:123286 . The gene structure includes protein-coding exons that translate to a 337 amino acid protein .

Regarding regulation, the available data suggests:

  • Developmental regulation: Expression patterns may vary throughout zebrafish development, though specific temporal expression data is limited in the current literature

  • Tissue-specific expression: While comprehensive expression data is not fully available , abhd13 likely follows similar expression patterns to its orthologs in other species, which show expression in multiple tissues including brain and liver

  • Response to environmental factors: Studies on rat Abhd13 suggest that expression can be modulated by various chemical compounds, including:

    • Decreased expression in response to 17beta-estradiol

    • Increased expression in response to 2-methoxyethanol

    • Altered expression in response to tetrachlorodibenzodioxin

These regulatory patterns suggest complex transcriptional control that may be conserved across species.

What are the optimal conditions for producing recombinant zebrafish abhd13 protein?

Production of recombinant zebrafish abhd13 typically involves:

  • Expression systems:

    • Yeast expression systems have been successfully used

    • Insect cell (baculovirus) systems may also be suitable based on success with other zebrafish recombinant proteins

  • Purification strategy:

    • Affinity chromatography using tag-based systems (His or GST tags are common)

    • Purity verification by SDS-PAGE (target >85%)

  • Buffer composition:

    • Tris-based buffers are typically used

    • 50% glycerol is recommended for stability

    • Buffer optimization may be required for specific applications

  • Expression conditions:

    • Temperature, induction timing, and media composition should be optimized based on the expression system

    • For partial protein expression, specific regions with higher solubility may be targeted

After expression and purification, recombinant abhd13 should be aliquoted to avoid freeze-thaw cycles and stored appropriately (see next question).

What are the optimal storage conditions for preserving activity of recombinant zebrafish abhd13?

Based on product information for recombinant zebrafish abhd13:

  • Long-term storage:

    • Store at -20°C or -80°C

    • Liquid formulations have a shelf life of approximately 6 months

    • Lyophilized formulations can maintain stability for up to 12 months

  • Working aliquots:

    • Store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can significantly reduce protein activity

  • Storage buffer composition:

    • Tris-based buffer with 50% glycerol is recommended

    • Buffer should be optimized specifically for abhd13 stability

  • Reconstitution (for lyophilized protein):

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

    • A default final concentration of 50% glycerol is typically used

Stability testing under different conditions is recommended to ensure optimal activity for specific experimental applications.

How does zebrafish abhd13 compare functionally with its orthologs in other species?

Zebrafish abhd13 shares functional characteristics with orthologs from other species:

  • Conservation of function:

    • Human ABHD13, mouse Abhd13, and zebrafish abhd13 are all predicted to enable palmitoyl-(protein) hydrolase activity

    • All are predicted to be involved in lipid metabolic processes and protein depalmitoylation

    • All are localized in membranes

  • Sequence homology:

    • Zebrafish abhd13 is orthologous to human ABHD13

    • The protein contains conserved domains including the alpha/beta hydrolase fold that is characteristic of this enzyme family

  • Species-specific differences:

    • Temperature adaptations: While no specific data is available for abhd13, studies on other zebrafish enzymes like Abcb4 show they have evolved to function across a wider temperature range (18°C–40°C) compared to their human counterparts, which are optimized for constant body temperature

    • These adaptations often manifest as differences in activation energy (Ea) and temperature sensitivity of enzymatic activity

  • Evolutionary conservation:

    • ABHD13 is highly conserved across vertebrates, being found in species ranging from fish to mammals, including human, mouse, rat, chicken, and other vertebrates

    • This high degree of conservation suggests important biological functions that have been maintained throughout vertebrate evolution

What experimental methods are most effective for studying zebrafish abhd13 enzymatic activity?

Several complementary approaches can be used to study zebrafish abhd13 enzymatic activity:

  • In vitro enzymatic assays:

    • Palmitoyl-(protein) hydrolase activity assays using fluorogenic or chromogenic substrates

    • HPLC or mass spectrometry-based assays to detect specific lipid metabolites

    • Activity-based protein profiling (ABPP) using serine hydrolase-directed probes

  • Inhibitor studies:

    • ABHD family inhibitors like β-aminocyano(MIDA)boronates or N-hydroxyhydantoin carbamates can be used to probe function

    • Temperature-dependent inhibition studies to characterize enzyme kinetics

    • Competitive ABPP assays to determine inhibitor specificity

  • Substrate identification:

    • Lipidomic approaches to identify natural substrates

    • Comparative studies with human ABHD13 to identify conserved substrates

    • Metabolomic profiling before and after inhibition or knockdown

  • Expression systems for functional testing:

    • Cell-based assays using zebrafish cell lines

    • Heterologous expression in mammalian or insect cells

    • In vitro translation systems for rapid screening

When designing these experiments, temperature considerations are important as zebrafish proteins may have different optimal temperature ranges compared to mammalian proteins .

What genetic approaches can be used to study abhd13 function in zebrafish models?

Several genetic approaches can be employed to investigate abhd13 function in zebrafish:

  • CRISPR-Cas9 genome editing:

    • Design guide RNAs targeting the abhd13 coding sequence

    • Create knockout models to study loss-of-function phenotypes

    • Generate knock-in models with fluorescent tags for localization studies or point mutations to study specific catalytic residues

    • Use conditional approaches with tissue-specific promoters for targeted expression

  • Morpholino knockdown:

    • Design antisense morpholinos targeting abhd13 mRNA

    • Useful for early developmental studies

    • Compare with CRISPR results to validate phenotypes

  • Transgenic reporter lines:

    • Create fluorescent fusion constructs similar to approaches used for other zebrafish proteins

    • Generate knock-in reporters at the endogenous locus to preserve regulatory elements

    • Example approach: "We used TALENs to introduce a double-strand break near the start codon in exon 1... One-cell stage embryos were injected with TALEN mRNA and donor constructs"

  • Compound genetic models:

    • Create double or triple knockouts combining abhd13 with related genes

    • Study in conjunction with Notch pathway components based on the importance of Notch signaling in zebrafish development

    • Use compound knockdowns to identify genetic interactions and redundancy

These genetic approaches can be particularly powerful when combined with phenotypic analysis focused on lipid metabolism, membrane dynamics, and neurological development.

What is the potential role of zebrafish abhd13 in modeling human neurological disorders?

Zebrafish abhd13 shows promise for modeling human neurological disorders based on several lines of evidence:

  • Orthology to human ABHD13:

    • Human ABHD13 has been linked to neurological disorders including Alzheimer's disease, Parkinson's disease, and neurodevelopmental disorders

    • The conserved function between species suggests zebrafish models could recapitulate key disease mechanisms

  • Phospholipid metabolism connection:

    • Human ABHD13 plays a crucial role in phospholipid metabolism in the brain, particularly in the hippocampus

    • Disruptions in ABHD13 function can lead to impairments in neuronal communication

    • Zebrafish abhd13 likely shares this functional role, making it relevant for neurological research

  • Advantages of zebrafish models:

    • Transparency of zebrafish larvae enables in vivo imaging of brain development

    • High-throughput screening capabilities for drug discovery

    • Ability to create genetic models that mimic human mutations

    • Existing zebrafish models have successfully identified high-risk genetic features in other diseases

  • Potential research applications:

    • Study the effects of abhd13 mutations on brain development and function

    • Screen for compounds that modulate abhd13 activity as potential therapeutics

    • Investigate interactions between abhd13 and other genes implicated in neurological disorders

    • Examine the role of abhd13 in lipid metabolism and membrane dynamics in neurons

Example research approach: "Using a technique called serial transplantation, the research team studied T-ALL in zebrafish and selected cancer cells from those in which the disease advanced more rapidly for further testing. This method allowed the research team to zero in on genes associated with T-ALL's most aggressive forms." Similar approaches could be applied to study abhd13 in neurological disease contexts.

How can advanced proteomic approaches be used to study abhd13 interactions and modifications?

Advanced proteomic approaches offer powerful tools for understanding abhd13's biological context:

  • Interactome analysis:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity to abhd13

    • Yeast two-hybrid screening to identify direct protein interactors

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

  • Post-translational modifications:

    • Phosphoproteomic analysis to identify regulatory phosphorylation sites

    • Analysis of palmitoylation status, particularly relevant given abhd13's predicted depalmitoylation activity

    • Ubiquitylation and SUMOylation profiling to understand regulatory mechanisms

  • Activity-based protein profiling (ABPP):

    • Use of serine hydrolase-directed probes to assess catalytic activity

    • Competitive ABPP with inhibitors to understand pharmacology

    • MS-based ABPP using stable isotope labeling with amino acids in cell culture (SILAC) for quantitative analysis

  • Structural proteomics:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational dynamics

    • Limited proteolysis coupled with MS (LiP-MS) to identify structural domains

    • Native MS to characterize oligomeric states and protein complexes

Implementation example: "The authors further investigated the selectivity of compound by MS-based ABPP using stable isotope labeling with amino acids in cell culture (SILAC). This technique allowed to confirm the selectivity on ABHD3 (>95% of blockade at 0.5 μM) without detecting any activity over 60 additional serine hydrolases in human cell lines." Similar approaches could be applied to study zebrafish abhd13 specificity and binding partners.

What are the implications of abhd13's predicted palmitoyl-(protein) hydrolase activity in zebrafish development and physiology?

The predicted palmitoyl-(protein) hydrolase activity of zebrafish abhd13 likely has significant developmental and physiological implications:

  • Protein depalmitoylation and signaling:

    • Palmitoylation is a reversible post-translational modification that regulates protein localization and function

    • Depalmitoylation by enzymes like abhd13 can dynamically regulate protein trafficking between membranes and cytosol

    • This activity could regulate key developmental signaling pathways, potentially including Notch signaling which is crucial for zebrafish development

  • Membrane dynamics and lipid metabolism:

    • Abhd13's predicted membrane localization suggests a role in membrane organization

    • Could influence lipid droplet formation and metabolism, similar to other lipid-processing enzymes studied in zebrafish

    • May regulate membrane fluidity and composition through its hydrolase activity

  • Neurological development:

    • If functions are conserved with human ABHD13, zebrafish abhd13 might play important roles in:

      • Neuronal communication and synapse formation

      • Brain development, particularly in regions homologous to the mammalian hippocampus

      • Protection against neurodegeneration through proper lipid homeostasis

  • Response to environmental factors:

    • Expression patterns of abhd13 orthologs are affected by various chemicals

    • This suggests abhd13 might be involved in adaptive responses to environmental changes

    • Could play a role in zebrafish stress responses or toxicant exposure

Future research utilizing targeted gene editing combined with lipidomic profiling and developmental phenotyping would help clarify these potential roles. Comparison with human ABHD13 function could provide valuable insights into conserved mechanisms across vertebrates.

What are the most promising future directions for zebrafish abhd13 research?

Several promising research directions could advance our understanding of zebrafish abhd13:

  • Structural biology approaches:

    • Determination of crystal or cryo-EM structures to understand catalytic mechanisms

    • Structure-based design of specific inhibitors or activity probes

    • Comparative structural analysis with human ABHD13 to identify conserved features

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and lipidomics

    • Network analysis to position abhd13 within lipid metabolism pathways

    • Temporal analysis of abhd13 activity throughout zebrafish development

  • Translational research applications:

    • Development of zebrafish abhd13 models for neurological disorders

    • High-throughput screening for modulators of abhd13 activity

    • Comparative studies with human ABHD13 to validate zebrafish as a model organism

  • Advanced imaging approaches:

    • Development of activity-based fluorescent probes specific for abhd13

    • In vivo imaging of abhd13 localization and dynamics using approaches similar to those used for lipid droplet visualization

    • Super-resolution microscopy to understand subcellular localization

  • Environmental toxicology applications:

    • Investigation of abhd13 as a biomarker for environmental toxicant exposure

    • Studies on how environmental factors affect abhd13 expression and activity

    • Examination of abhd13's role in adaptive responses to changing environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.