Recombinant Danio rerio Abhydrolase domain-containing protein 2-A (abhd2a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
abhd2a; abhd2; zgc:55722; Monoacylglycerol lipase ABHD2; 2-arachidonoylglycerol hydrolase; Abhydrolase domain-containing protein 2-A; Acetylesterase; Triacylglycerol lipase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-432
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
abhd2a
Target Protein Sequence
MNTHESEVYTVAPEMPAMFDGMKLAAVATVLYVIVRCLNLKSPTAPPDLTFQDTTLNHFL LKSCPILTKEYIPPLLWGKSGHLQTALYGKLGRVSSPHPFGLRKYLPMQDGATATFDLFE PLADHQSGEDVTMVICPGIGNHSEKHYIRTFVDHSQKQGYRCAVLNHLGALPNIELTSPR MFTYGCTWEFAAMVGFIKKTYPQSKLIVVGFSLGGNIVCKFLGENRTNQERVLCCVSVCQ GYSALRAQETFLQWDQCRRFYNFLMADNMKKIILSHRGVLFGVGSKMVDSELSRLYTATS LMQIDDNIMRKFHGHNSLKEYYEKESCVHYIHNINVPLLLVNSVDDPLVHNSLLTIPRTL AEKKENVVFALTLHGGHLGFFEGAVLFPQPLTWMDKVIVDYATAMCQWEKQKPPCQSKDA QSNQTTCQENTS
Uniprot No.

Target Background

Function
Recombinant Danio rerio Abhydrolase domain-containing protein 2-A (abhd2a) is a progesterone-dependent acylglycerol lipase. It catalyzes the hydrolysis of the endocannabinoid arachidonoylglycerol (AG) from cell membranes. Functioning as a progesterone receptor, progesterone binding activates its acylglycerol lipase activity, mediating the degradation of 1-arachidonoylglycerol (1AG) and 2-arachidonoylglycerol (2AG) into glycerol and arachidonic acid (AA). It also exhibits ester hydrolase activity against acetyl, butanoate, and hexadecanoate esters. In sperm capacitation, abhd2a plays a key role in responding to progesterone by degrading 2AG, an inhibitor of the sperm calcium channel CatSper. This degradation leads to calcium influx via CatSper and subsequent sperm activation. Abhd2a may also contribute to smooth muscle cell migration.
Database Links
Protein Families
AB hydrolase superfamily, AB hydrolase 4 family
Subcellular Location
Cell membrane; Single-pass type II membrane protein.

Q&A

What is abhd2a in zebrafish and how does it relate to human ABHD2?

Abhydrolase domain-containing protein 2-A (abhd2a) is a serine hydrolase enzyme belonging to the α,β-hydrolase fold-containing protein family in Danio rerio (zebrafish). It shares significant functional homology with human ABHD2, which plays key roles in sperm hyperactivation, viral propagation, and immune response. The zebrafish abhd2a protein is encoded by the abhd2a gene (previously also referred to as abhd2) and contains 432 amino acids . Sequence alignment studies show moderate conservation between species, with zebrafish protein sharing approximately 60-70% of its genetic sequence with human ABHD2 .

The functional comparison between species is particularly important when using zebrafish as a model organism for human disease studies. While human ABHD2 is known to cleave 2-arachidonoylglycerol (2AG) in the presence of progesterone, triggering calcium influx necessary for sperm hyperactivation, the zebrafish ortholog's specific enzymatic activity requires further characterization .

What are the optimal conditions for handling recombinant Danio rerio abhd2a protein in laboratory settings?

Based on available data for recombinant abhd2a protein, the following handling guidelines are recommended:

Storage and Stability:

  • Store at -20°C for regular use

  • For long-term storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles; prepare working aliquots to be stored at 4°C for up to one week

  • Typically supplied in Tris-based buffer with 50% glycerol optimized for protein stability

Activity Considerations:

  • Enzymatic activity is optimal at physiological pH (7.2-7.4)

  • Temperature sensitivity should be considered; activity assays are typically conducted at 28°C (zebrafish physiological temperature)

  • Serine hydrolase inhibitors, such as phenylmethylsulfonyl fluoride (PMSF), should be avoided during experimental procedures unless they are the subject of study

Biochemical Assay Compatibility:

  • Compatible with activity-based protein profiling (ABPP) using β-lactone-based activity-based probes such as MB064 and MB108

  • Functional assays should consider its hydrolase activity, potentially using fluorescent or colorimetric substrates

How can researchers effectively employ activity-based protein profiling to study abhd2a function?

Activity-based protein profiling (ABPP) has emerged as a powerful technique for studying hydrolases like abhd2a. Implementing this approach involves several key steps:

  • Probe Selection: β-lactone-based activity-based probes (ABPs) like MB064 and MB108 have been validated for targeting a broad range of serine hydrolases including ABHD family proteins .

  • Competitive ABPP Screening: To identify selective inhibitors or assess enzyme activity:

    • Pre-incubate protein samples with potential inhibitors or test compounds

    • Add the activity-based probe that will bind to the active site of uninhibited enzymes

    • Visualize labeled proteins via SDS-PAGE and fluorescence scanning or mass spectrometry

  • Data Analysis Protocol:

    • Quantify labeling intensity compared to vehicle-treated controls

    • A reduction in labeling >70% typically qualifies as significant inhibition

    • Create protein-inhibitor interaction profiles across compound libraries

This approach has successfully identified selective inhibitors for related ABHD proteins, revealing that different inhibitor classes (α-ketoamides, β-ketoamides, and 1,2,4-triazole ureas) exhibit distinct selectivity profiles across ABHD family members .

A library-versus-library screening approach can be particularly effective, where multiple ABHD proteins are simultaneously tested against a focused inhibitor library (>200 compounds), yielding comprehensive selectivity data in a single experiment.

What advantages does the zebrafish model offer for studying abhd2a compared to other model organisms?

Zebrafish (Danio rerio) provides several distinct advantages for abhd2a research:

Genetic and Physiological Advantages:

  • Shares 70% of genes with humans, including more than 84% of genes associated with human genetic diseases

  • Conserved organ systems including brain, heart, liver, and reproductive organs with functional similarity to human counterparts

  • Complete genome sequencing facilitates genetic manipulation and analysis

Developmental and Practical Benefits:

  • Rapid development with most major organs formed within 24 hours

  • Transparent embryos allowing real-time visualization of developmental processes

  • High fecundity (up to 300 embryos every 2-3 days) enabling large-scale studies

  • External fertilization providing easy access to embryos for manipulation

  • Lower maintenance costs compared to rodent models

Experimental Versatility:

  • Amenable to various genetic manipulation techniques including CRISPR/Cas9, morpholino knockdown, and transgenic approaches

  • Well-established methods for in situ hybridization to study gene expression patterns

  • Compatibility with high-throughput screening approaches

Research indicates that zebrafish can effectively model the physiological roles of abhd2a, particularly in developmental processes, making it a valuable system for understanding the protein's function in vertebrates.

What are the established genetic manipulation techniques for studying abhd2a function in zebrafish?

Several genetic approaches have been validated for investigating abhd2a function in zebrafish:

CRISPR/Cas9 Gene Editing:

  • Design guide RNAs targeting specific regions of the abhd2a gene

  • Inject CRISPR components into one-cell stage embryos

  • Screen F0 or F1 generations for mutations using sequencing or restriction enzyme digestion

  • This approach allows creation of stable knockout lines for long-term studies

Morpholino Knockdown:

  • Design antisense morpholinos targeting the translation start site or splice junctions of abhd2a mRNA

  • Inject morpholinos into one-cell stage embryos

  • Validate knockdown efficiency via Western blot or RT-PCR

  • Useful for rapid assessment of gene function but consider potential off-target effects

Transgenic Overexpression:

  • Generate Tol2 transposon-based constructs containing the abhd2a gene under tissue-specific promoters

  • Co-inject with transposase mRNA into one-cell stage embryos

  • Screen F1 generation for stable integration and expression

  • This approach facilitates tissue-specific functional studies

In Situ Hybridization for Expression Pattern Analysis:

  • Design antisense RNA probes specific to abhd2a transcripts

  • Apply color-based or fluorescence-based detection methods

  • Multiple-probe approaches using HCR amplification can allow co-localization studies

  • This provides spatial and temporal expression data during development

Researchers should consider combining approaches for comprehensive functional characterization. For example, phenotypes observed in CRISPR knockout lines can be validated through rescue experiments using mRNA injection or transgenic overexpression.

How do the functions of zebrafish abhd2a compare with human ABHD2, particularly in disease contexts?

While human ABHD2 and zebrafish abhd2a share structural similarities, there are important functional parallels and differences that researchers should consider:

Conserved Functions:

  • Both function as serine hydrolases with similar catalytic mechanisms

  • Both are involved in lipid metabolism pathways

  • Expression patterns show some conservation across tissues

Disease Relevance Comparison:

ConditionHuman ABHD2Zebrafish abhd2aResearch Implications
Respiratory disordersDownregulated in emphysema; maintains phosphatidylcholine levels in lungsExpression in gill tissue suggests possible respiratory functionPotential model for studying ABHD2's role in lung homeostasis
Cardiovascular diseaseExpressed in atherosclerotic lesions; higher in unstable vs. stable anginaHeart expression detected; function not yet fully characterizedMay offer insights into ABHD2's role in vascular inflammation
Reproductive biologyCritical for sperm hyperactivation through progesterone-induced 2AG hydrolysisExpressed in reproductive tissuesCould serve as model for certain aspects of mammalian fertility
CancerPromotes prostate cancer growth; associated with poor survival and chemotherapy resistanceNot yet characterized in cancer contextsTransgenic zebrafish models could evaluate oncogenic potential

What is known about the role of abhd2a in zebrafish neural development and function?

While research on abhd2a's specific role in zebrafish neurodevelopment is still emerging, several lines of evidence suggest important neurological functions:

Expression Pattern:
Studies have detected abhd2a expression in developing zebrafish brain tissues, suggesting potential roles in neural development or function. This parallels findings in mammalian systems where ABHD2 has neurological implications.

Functional Indicators:
Zebrafish models have demonstrated that disruptions in lipid metabolism pathways can significantly impact neurodevelopment and behavior. Given abhd2a's role in lipid metabolism, it may contribute to:

  • Neural membrane composition and maintenance

  • Signaling lipid regulation in developing brain circuits

  • Potential modulation of neurotransmitter systems

Research Approaches:
Investigations into abhd2a's neural functions typically employ:

  • In situ hybridization to map expression patterns in developing neural tissues

  • Behavioral assays following genetic manipulation to assess cognitive and motor impacts

  • Fluorescent reporter lines to visualize expression in specific neural cell populations

  • Electrophysiological recordings to measure potential impacts on neural activity

Researchers studying zebrafish models of Fragile X Syndrome and other neurodevelopmental conditions should consider evaluating abhd2a expression and function, as altered lipid metabolism has been implicated in these disorders .

What are the common challenges in expressing and purifying recombinant Danio rerio abhd2a and how can they be addressed?

Researchers working with recombinant abhd2a often encounter several technical challenges:

Expression System Selection:
Recombinant abhd2a has been successfully expressed in various systems including yeast and E. coli . Key considerations include:

  • Prokaryotic systems may offer higher yields but lack post-translational modifications

  • Yeast systems provide eukaryotic processing capabilities with moderate yields

  • Insect cell systems may better preserve enzymatic activity for functional studies

  • Codon optimization for the chosen expression system is recommended for optimal yields

Solubility Issues:
As a membrane-associated protein, abhd2a may exhibit solubility challenges:

  • Inclusion body formation is common in E. coli systems

  • Addition of solubilizing agents (0.1-1% detergents like Triton X-100 or CHAPS) during lysis can improve recovery

  • Consider expressing truncated versions lacking transmembrane domains for improved solubility

  • Co-expression with chaperone proteins may enhance proper folding

Purification Strategy:
A systematic approach to purification includes:

  • Affinity chromatography using histidine tags or fusion partners (GST, MBP)

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography for final polishing

  • Activity assays at each purification step to track functional protein recovery

Stability Considerations:
To maintain enzyme activity:

  • Include glycerol (20-50%) in storage buffers

  • Add reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation

  • Consider flash-freezing in liquid nitrogen rather than slow freezing

  • Store small aliquots to minimize freeze-thaw cycles

How can researchers effectively design experiments to compare zebrafish abhd2a with other ABHD family members?

Designing comparative studies across ABHD family members requires careful methodological planning:

Experimental Design Strategy:

  • Protein Library Preparation:

    • Express multiple ABHD proteins under identical conditions

    • Prepare two distinct protein libraries if needed for proper resolution (e.g., ABHD2, 3, and 12 in one library; ABHD4, 6, 11, and 16A in another)

    • Standardize protein concentrations across samples

  • Functional Characterization:

    • Employ activity-based protein profiling with broad-spectrum probes that target multiple family members

    • Conduct substrate preference assays using a panel of potential lipid substrates

    • Assess inhibitor profiles using focused chemical libraries

  • Comparative Analysis Framework:

    • Establish clear metrics for comparison (enzyme kinetics, substrate specificity, inhibitor sensitivity)

    • Use statistical approaches appropriate for multiple comparisons

    • Consider both qualitative (substrate preferences) and quantitative (kinetic parameters) comparisons

Visualization and Analysis Methods:

  • Heat maps depicting activity profiles across multiple proteins and conditions

  • Principal component analysis to identify clustering patterns

  • Hierarchical clustering to establish evolutionary relationships based on functional properties

This approach has successfully identified distinct inhibitor class preferences among ABHD family members, with α-ketoamides, β-ketoamides, and 1,2,4-triazole ureas showing different selectivity profiles .

What emerging technologies are advancing the study of abhd2a function in zebrafish?

Several cutting-edge methodologies are transforming abhd2a research:

Advanced Genome Editing Approaches:

  • Base editing and prime editing technologies allow precise nucleotide changes without double-strand breaks

  • Conditional knockout systems using Cre-lox or similar approaches enable temporal control of gene deletion

  • CRISPR activation/interference (CRISPRa/CRISPRi) permits modulation of gene expression without altering the sequence

Single-Cell Transcriptomics:
Researchers have employed single-cell RNA sequencing to identify cell populations expressing abhd2a at different developmental stages. This approach has revealed:

  • Cell-type specific expression patterns across development

  • Co-expression networks that suggest functional associations

  • Dynamic temporal regulation during key developmental transitions

Recent work has identified abhd2a expression in a BBB vasculature subcluster (hema.28) as early as 24 hours post-fertilization, providing new insights into its potential vascular functions .

Whole-Brain Imaging Technologies:

  • Light sheet microscopy combined with tissue clearing techniques enables visualization of abhd2a expression throughout intact zebrafish brains

  • Reporter lines expressing fluorescent proteins under the abhd2a promoter allow real-time tracking of expression

  • Integration with behavioral analysis creates powerful platforms for structure-function studies

High-Content Screening Approaches:
Automated phenotypic screening in zebrafish embryos combined with CRISPR-based gene editing allows rapid assessment of abhd2a function in various developmental contexts.

What are the current gaps in understanding abhd2a function that require further investigation?

Despite progress in characterizing abhd2a, several critical knowledge gaps remain:

Enzymatic Function:

  • The specific endogenous substrates of zebrafish abhd2a remain largely unidentified

  • The catalytic efficiency (Kcat/Km) against potential substrates has not been systematically measured

  • Regulatory mechanisms controlling abhd2a activity in vivo require characterization

Developmental Roles:

  • The precise function of abhd2a during embryonic development is not fully understood

  • Potential roles in specific developmental processes like neurogenesis or vascular development need investigation

  • Long-term consequences of abhd2a dysregulation on adult physiology remain unexplored

Disease Relevance:

  • The potential contribution of abhd2a to zebrafish models of human diseases needs further exploration

  • Functional conservation between zebrafish abhd2a and human ABHD2 in disease contexts requires validation

  • Therapeutic targeting potential remains largely unexplored

Comparative Biology:

  • Functional differences between zebrafish paralogs (abhd2a and potential related genes) are not well characterized

  • Evolutionary conservation of enzymatic function across vertebrate species requires systematic investigation

Addressing these gaps will require interdisciplinary approaches combining structural biology, biochemistry, developmental biology, and comparative genomics. Methodological innovations in protein characterization and in vivo imaging will be particularly valuable for advancing this field.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.