Recombinant Danio rerio Acyl-CoA-binding domain-containing protein 5-B (acbd5b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. To ensure a specific tag, please inform us in advance; we will prioritize its implementation.
Synonyms
acbd5b; si:ch211-112d19.6; Acyl-CoA-binding domain-containing protein 5-B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-410
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
acbd5b
Target Protein Sequence
MILRGMEDSKSAQKRFEAAVKVIRSLPEDGSYDLSDDMLVLFYSYYKQATEGPCNTLKPN SWDPIGKAKWEAWKDLGNMSKDQAMTEYVQEIQLIIETLPVTDRMAELLDALDPFYEIVE DDDDDDDEGVSKAAPLFTGSTNADKDAERDEEVESESKEGNLDDYMELVEKQKDLSSTTG EKGSLLVFNRSEENSISSLTDGTHSSLNTVDDEEELVYDGSDDEMDSDSMDKPATPEKGS GVRSVRLADGSVVGANMQHGGNREPQCGSQDGKPQGLISPVPHPPTLGTVRNDRISACSG RERGCQGDGGQRGETADRMDKQAINTQITTILSELEDNMQDVLRRLTTLEQLTASQAEIS PSKTWHSDKPKKRLSWWPLNSSPFTAVLTVLWPFAVHWLVQFYLQRRRRR
Uniprot No.

Target Background

Function

Binds medium- and long-chain acyl-CoA esters.

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Danio rerio acbd5b and why is it significant in research?

Acyl-CoA-binding domain-containing protein 5-B (acbd5b) is a protein expressed in zebrafish (Danio rerio), which serves as a crucial component in cellular membrane contact sites. The significance of acbd5b lies in its role as a peroxisomal membrane protein that forms tethering complexes with the endoplasmic reticulum (ER) through interaction with VAPB (vesicle-associated membrane protein-associated protein B) . This tethering mechanism is essential for lipid metabolism and transfer between organelles. Zebrafish provide an excellent model for studying this protein due to their genetic similarity to humans, with approximately 70% shared genes and more than 84% of the genes that cause genetic disease in humans .

What are the optimal storage and handling conditions for recombinant Danio rerio acbd5b?

For optimal storage and handling of recombinant Danio rerio acbd5b:

  • Store the protein at -20°C for routine use, or at -80°C for extended storage periods

  • Use a Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoid repeated freezing and thawing cycles as this can compromise protein integrity

  • For working aliquots, store at 4°C for up to one week

  • When conducting experiments, maintain protein samples on ice to minimize degradation

These conditions help preserve the structural integrity and functionality of the recombinant protein for experimental applications.

How do researchers typically generate CRISPR-based mutants of acbd5b in Danio rerio?

To generate CRISPR-based mutants of acbd5b in Danio rerio, researchers typically follow this methodology:

  • gRNA Design: Use tools like CHOPCHOP online database (https://chopchop.cbu.uib.no) to identify optimal guide RNA sequences targeting the acbd5b gene

  • Injection Protocol: Microinject CRISPR components (Cas9/Cas12a enzyme + gRNA) into one-cell stage zebrafish embryos

  • F0 Screening: Analyze F0 crispant embryos for mutations using fragment analysis to detect indels

  • Founder Identification: Fin clip adult F0 fish and screen for the presence of indels using fragment analysis

  • Germline Transmission: Outcross F0 carriers to generate F1 heterozygotes

  • Mutation Characterization: Sequence F1 embryo DNA via direct PCR and TOPO cloning to identify specific mutations

  • Stable Line Establishment: Raise F1 carriers to establish stable mutant lines

Fragment analysis using platforms like the Agilent 5300 Fragment Analyzer can detect indels as small as 2 base pairs with high resolution, making it particularly effective for screening potential mutants .

How do phosphorylation patterns regulate acbd5b-VAPB interactions in membrane contact sites?

The interaction between acbd5b and VAPB at peroxisome-ER membrane contact sites is regulated through a complex phosphorylation mechanism:

  • Phosphorylation Sites: Multiple phosphorylation sites exist within the FFAT-like motif of acbd5b and its flanking regions

  • Differential Regulation: Phosphorylation at different sites within the FFAT-like motif can either enhance or inhibit binding to VAPB

  • Kinase Involvement: GSK3β (glycogen synthase kinase-3 beta) has been identified as a key regulator of this interaction

  • Mechanistic Model:

    • Phosphorylation in the flanking regions can prime the FFAT motif for additional phosphorylation events

    • Core phosphorylation in the FFAT motif directly alters VAPB binding affinity

    • Phosphatases counteract these modifications to dynamically control contact site formation

This phosphoregulation provides a dynamic mechanism for controlling the formation and dissolution of peroxisome-ER contacts in response to cellular needs. Experiments using phosphatase inhibitors and site-directed mutagenesis of phosphorylation sites demonstrate significant changes in binding affinity and contact site formation .

How can the function of acbd5b be studied using zebrafish behavioral assays?

Studying acbd5b function through zebrafish behavioral assays requires a methodical approach:

  • Novel Tank Test: This assay evaluates anxiety-like behaviors that might result from peroxisomal dysfunction

    • Place zebrafish in a novel tank environment

    • Record and analyze swimming patterns, vertical position, freezing behavior, and erratic movements

    • Compare wild-type and acbd5b mutant responses

  • Social Preference Test: As lipid metabolism affects neurological development:

    • Use a three-chamber apparatus with conspecifics in one chamber

    • Measure time spent near conspecifics versus empty chambers

    • Analyze differences between control and acbd5b-deficient fish

  • Experimental Design Considerations:

    • Control for sex differences (females typically show higher anxiety-like behaviors)

    • Standardize housing conditions (5 fish/L is optimal)

    • Use nutritionally rich feeds to minimize stress confounds

    • Minimize environmental stressors like noise and transportation

  • Data Analysis:

    • Apply repeated measures ANOVA for time-course experiments

    • Use heteroscedastic one-way repeated measures ANOVA for trimmed means when normality assumptions are violated

These behavioral paradigms can reveal phenotypes resulting from disrupted lipid metabolism due to acbd5b dysfunction, particularly in the context of neurodevelopmental processes.

What experimental approaches allow for real-time visualization of acbd5b-mediated peroxisome-ER contact sites?

Real-time visualization of acbd5b-mediated peroxisome-ER contact sites in zebrafish can be achieved through several advanced imaging techniques:

  • Fluorescent Protein Tagging:

    • Generate constructs encoding acbd5b-GFP fusion proteins

    • Co-express with ER markers (e.g., mCherry-VAPB or mCherry-Sec61β)

    • Microinject mRNA into one-cell stage embryos for transient expression

    • Use confocal microscopy to visualize colocalization patterns

  • FRET-Based Approaches:

    • Create donor-acceptor pairs using acbd5b-CFP and VAPB-YFP

    • Measure FRET efficiency to quantify protein-protein interactions

    • Changes in FRET signal upon phosphatase or kinase inhibitor treatment reveal regulatory mechanisms

  • Split-GFP Complementation:

    • Express one GFP fragment fused to acbd5b and the complementary fragment fused to VAPB

    • GFP fluorescence only occurs when proteins interact, creating contact sites

    • Quantify fluorescence intensity to measure contact site abundance

  • Live Imaging in Zebrafish Embryos:

    • Leverage the transparency of zebrafish embryos for in vivo imaging

    • Focus on tissues with high metabolic activity (brain, liver, muscle)

    • Employ time-lapse microscopy to track dynamic changes in contact site formation

These approaches, combined with pharmacological interventions targeting GSK3β or other regulatory kinases, provide insights into the spatial and temporal dynamics of peroxisome-ER contacts mediated by acbd5b.

How does acbd5b function differ between in vitro biochemical assays and in vivo zebrafish models?

The function of acbd5b shows important differences between in vitro biochemical studies and in vivo zebrafish models:

ParameterIn Vitro Biochemical AssaysIn Vivo Zebrafish Models
Binding KineticsDirect measurement of acbd5b-VAPB binding affinities using purified proteinsComplex interactions influenced by cellular environment and competing binding partners
PhosphorylationControlled phosphorylation states using purified kinases/phosphatasesDynamic regulation through multiple signaling pathways
Organelle DynamicsStatic assessment of binding using fixed concentrationsDynamic remodeling of organelle contacts in response to metabolic demands
Functional OutcomesLimited to molecular interactionsObservable phenotypic consequences (development, behavior, metabolism)
Temporal ResolutionSnapshot measurementsDevelopmental timeline from embryo to adult
Genetic CompensationAbsentPotential upregulation of paralogous genes in response to acbd5b mutation

To bridge these differences, researchers employ complementary approaches:

  • Validate in vitro findings using cell culture systems from zebrafish tissues

  • Correlate biochemical measurements with in vivo phenotypes

  • Use pharmacological interventions in vivo to target specific aspects of acbd5b function identified in vitro

  • Develop zebrafish lines expressing modified forms of acbd5b (phosphomimetic or phospho-dead mutations) to test hypotheses derived from biochemical studies

What methodological approaches can resolve contradictions in acbd5b functional data between different experimental systems?

When faced with contradictory data regarding acbd5b function across different experimental systems, researchers can employ these methodological approaches:

  • Systematic Comparison of Experimental Conditions:

    • Create a standardized matrix of experimental variables (temperature, buffer composition, protein concentrations)

    • Identify critical parameters that influence experimental outcomes

    • Develop a consensus protocol that minimizes variability

  • Cross-Validation Across Multiple Systems:

    • Test hypotheses in parallel using:

      • In vitro biochemical assays with purified components

      • Cell culture models (both mammalian and fish cell lines)

      • Zebrafish embryos at different developmental stages

      • Adult zebrafish behavioral and physiological studies

  • Genetic Approach to Resolve Discrepancies:

    • Generate allelic series of acbd5b mutations (null, hypomorphic, phospho-mutants)

    • Create tissue-specific and inducible knockouts to distinguish primary from secondary effects

    • Perform rescue experiments with wild-type or modified acbd5b to verify specificity

  • Collaborative Multi-laboratory Validation:

    • Implement a standardized protocol across multiple research groups

    • Blind analysis of data to minimize bias

    • Pool results for meta-analysis to identify consistent effects and sources of variability

  • Advanced Statistical Approaches:

    • Apply heteroscedastic one-way repeated measures ANOVA for trimmed means

    • Calculate effect sizes using δt as described by Algina et al. (2005)

    • Use R statistical packages like WRS2 for robust statistical analysis

These approaches help identify whether contradictions arise from technical factors, biological variables, or fundamental differences in the systems being studied.

How can researchers develop targeted modulators of acbd5b activity for experimental applications?

To develop targeted modulators of acbd5b activity for experimental applications, researchers can implement the following methodological approaches:

  • Structure-Based Design of Peptide Inhibitors:

    • Synthesize peptides mimicking the FFAT-like motif of acbd5b

    • Introduce modifications to enhance cell permeability (e.g., TAT sequence fusion)

    • Test competitive inhibition of acbd5b-VAPB interactions in cell-free and cellular systems

  • Small Molecule Screening:

    • Establish high-throughput binding assays using fluorescence polarization

    • Screen compound libraries for molecules that modulate acbd5b-VAPB interaction

    • Validate hits using secondary assays including cellular peroxisome-ER contacts

  • Genetic Modulators:

    • Design dominant-negative forms of acbd5b that retain binding capacity but lack functional domains

    • Develop photoactivatable variants using optogenetic approaches for temporal control

    • Create FKBP-FRB fusion systems for chemically-inducible dimerization to control contact site formation

  • Kinase/Phosphatase Targeting:

    • Use GSK3β inhibitors to modulate acbd5b phosphorylation state

    • Apply phosphatase inhibitors to maintain phosphorylated states

    • Develop site-specific approaches targeting only the relevant phosphorylation sites

  • Validation in Zebrafish Models:

    • Test modulators by microinjection into zebrafish embryos

    • Assess phenotypic outcomes using:

      • Lipid metabolism assays

      • Peroxisome distribution and morphology

      • Behavioral tests in larvae and adults

    • Monitor organelle contacts using the imaging techniques described in FAQ #7

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.