Recombinant Danio rerio Adenosine monophosphate-protein transferase FICD (ficd)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ficd; si:ch211-191d15.5; zgc:110336; Protein adenylyltransferase FICD; AMPylator FICD; FIC domain-containing protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ficd
Target Protein Sequence
MAALAVLRYAGSSPLLWGWGPILFGLLGSVFVLLLPLVGIEEQCCATLKGLALLRCQMWG GIQRPVVHTTSLAVPFTALDLLPQKVKPSKETQLEAKAALQQALEMKKSGKREKAHKLLV HALNMNPEFVEALTELGTILEEEKDVVQADHLYTKALAISPCHEKALVSRDRTLPLVEEI DQRHFGIIDGKVRRLMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHIIETR YAVPGKSLQEQNEAIGVDVAMKYINTTLLSRDGAITVNDILEIHRRVLGYADPVEAGRFR VNQVFVGHHIPPHPQDLDKHMQELVQWLNSEETLHLHPVEFAALAHYKLVYVHPFVDGNG RTSRLLMNLILMQASYPPITIRKEQRAEYYAALDTANEGDVRPFIRFIAKCTEMTLDTLL IATTEHAVGLPGASNHACPDCKQTIPVHS
Uniprot No.

Target Background

Function

Function: Adenylyltransferase mediating the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins.

Database Links

KEGG: dre:334648

UniGene: Dr.81867

Protein Families
Fic family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is FICD and what are its primary functions in zebrafish?

FICD (FIC domain-containing protein) is an adenylyltransferase that mediates the addition and removal of adenosine 5'-monophosphate (AMP) to specific residues of target proteins, a process called AMPylation and de-AMPylation. In zebrafish (Danio rerio), the ficd gene encodes a 449 amino acid protein that functions in various cellular processes .

The primary functions of FICD include:

  • Regulation of protein folding in the endoplasmic reticulum (ER)

  • Modulation of BiP/GRP78 chaperone activity through AMPylation

  • Participation in cellular stress responses

  • Potential roles in immune function regulation

FICD acts bi-functionally; it can both AMPylate and de-AMPylate target proteins, with the enzyme's activity state determined by specific residues like E234 . This dual functionality allows for precise regulation of target protein activity in response to cellular conditions.

How does zebrafish FICD structure relate to its function?

Zebrafish FICD contains several critical structural elements that determine its function:

  • The core FIC domain with the conserved HPFxxGNGR motif essential for AMPylation activity

  • A highly conserved region TLLFATTEY (aa 428-436) important for protein function

  • A critical glutamic acid residue (E234) that regulates the switch between AMPylation and de-AMPylation activities

The structural organization of FICD allows it to function as a molecular switch. According to research, the positioning of the E234-containing helix is crucial - when engaged in the active site, it blocks AMPylation and favors de-AMPylation. When disengaged, it promotes AMPylation . This conformational switching may be coupled to the burden of unfolded proteins in the ER, forming a regulatory mechanism that responds to cellular stress conditions.

What are the known protein interactions with zebrafish FICD?

Zebrafish FICD interacts with several proteins as part of its functional network. According to STRING interaction database analysis, the following proteins show significant interactions :

Protein PartnerFunctionInteraction Score
hspa5Immunoglobulin binding protein; Heat shock protein 70 family member0.894
ankrd45Ankyrin repeat domain 450.833
oatOrnithine aminotransferase0.664
rag2V(D)J recombination-activating protein 20.560
plagl2Pleiomorphic adenoma gene-like 20.558
ripk4Receptor-interacting serine-threonine kinase 40.558
psphPhosphoserine phosphatase0.556
rag1V(D)J recombination-activating protein 10.556
zic1ZIC family member 10.534

The strongest interaction is with hspa5 (BiP/GRP78), a major ER chaperone that is a primary target of FICD-mediated AMPylation . This interaction is particularly significant as BiP AMPylation affects protein folding and the unfolded protein response in the ER.

What methodologies are most effective for studying FICD-mediated AMPylation in zebrafish?

Studying FICD-mediated AMPylation in zebrafish requires specialized techniques. Based on current research approaches, the following methodologies have proven effective:

In vitro AMPylation assays:

  • Fluorescence polarization assays using fluorescent ATP analogs such as N6-(6-aminohexyl)-ATP-5-FAM to monitor AMPylation activity

  • Autoradiography with radioactively labeled ATP to visualize AMPylation of target proteins

  • Mass spectrometry analysis to identify modified residues and quantify AMPylation levels

In vivo approaches:

  • Generation of transgenic zebrafish lines expressing wild-type or mutant FICD

  • CRISPR-Cas9 gene editing to create FICD knockout or point mutations

  • Whole-mount in situ hybridization to visualize FICD expression patterns during development

  • Protein profiling throughout zebrafish embryogenesis using quantitative mass spectrometry

For recombinant protein studies:

  • Expression in bacterial systems (e.g., E. coli BL21 T7 Express cells)

  • Purification using affinity chromatography (GST-tag or His-tag)

  • Quality control via SDS-PAGE and Western blotting

  • Functional validation through enzymatic activity assays

A combination of these approaches provides comprehensive insights into FICD function and regulation in zebrafish.

How does the E234G mutation affect zebrafish FICD activity and what are its experimental implications?

The E234G mutation drastically alters FICD enzymatic activity by locking the enzyme in a constitutively AMPylating mode . This mutation has significant experimental implications:

Biochemical effects:

  • Wild-type FICD predominantly exhibits de-AMPylation activity in vitro

  • E234G mutation converts FICD into a constitutive AMPylase

  • The mutation prevents the E234 side chain from engaging with the active site, eliminating the regulatory switching mechanism

Experimental applications:

  • E234G mutants serve as valuable tools for studying AMPylation-specific effects

  • They allow researchers to bypass the natural regulatory mechanisms controlling FICD activity

  • The mutant can be used to identify novel AMPylation targets

Research protocol considerations:
When using FICD E234G in experiments, researchers should:

  • Include wild-type controls to compare natural vs. constitutive AMPylation

  • Consider the physiological relevance of increased AMPylation activity

  • Monitor potential off-target effects due to hyperactive AMPylation

  • Use site-directed mutagenesis to generate the E234G variant in expression constructs

As noted in research: "In vitro, the two forms of FICD, wildtype and E234G, represent the extremes of two opposing enzymatic activities... the E234G mutation locks FICD in a constitutively AMPylating mode" .

What are the technical challenges in producing functional recombinant Danio rerio FICD?

Production of functional recombinant zebrafish FICD presents several technical challenges that researchers need to address:

Expression system selection:

  • Bacterial systems may lack proper post-translational modifications

  • Mammalian expression systems better preserve native protein folding but have lower yields

  • Insect cell systems balance yield and post-translational modifications

Protein solubility and stability:

  • FICD contains hydrophobic regions that can reduce solubility

  • Special buffer considerations are needed (typically containing DTT or other reducing agents)

  • Storage recommendations include 50% glycerol and avoiding repeated freeze-thaw cycles

Purification protocol optimization:
Based on published protocols , effective purification requires:

  • Lysis in buffer containing 50 mM Tris-HCl pH 7.5, 500 mM NaCl, 1 mM MgCl₂, 2 mM DTT

  • Multiple washing steps with buffers containing varying concentrations of salt and detergent

  • Elution with glutathione for GST-tagged proteins

  • Optional tag removal using TEV protease

  • Size-exclusion chromatography for highest purity

Quality control:

  • Verification of enzymatic activity using fluorescence polarization assays

  • Confirmation of proper folding by circular dichroism

  • Assessment of protein homogeneity by dynamic light scattering

Adhering to these technical considerations significantly improves the likelihood of obtaining functionally active recombinant zebrafish FICD.

How can zebrafish FICD be used to study ER stress responses?

Zebrafish FICD serves as an excellent model for studying ER stress responses due to its conserved role in regulating BiP chaperone activity. Research approaches include:

Experimental design strategies:

  • Genetic manipulation approaches:

    • Generate transgenic zebrafish lines with fluorescently tagged FICD to monitor localization during stress

    • Create conditional FICD knockout/knockdown lines using CRISPR-Cas9 or morpholinos

    • Introduce point mutations (e.g., E234G) to alter FICD activity

  • ER stress induction protocols:

    • Chemical inducers: tunicamycin, thapsigargin, or DTT

    • Heat shock protocols

    • Hypoxia exposure

    • Expression of misfolding-prone proteins

  • Readouts for ER stress responses:

    • Quantification of BiP AMPylation levels via mass spectrometry

    • Monitoring unfolded protein response (UPR) gene expression

    • Assessing cell survival under stress conditions

    • Visualization of ER morphology changes

The bidirectional activity of FICD (AMPylation/de-AMPylation) serves as a regulatory mechanism that responds to the burden of unfolded proteins in the ER . When this burden is high, FICD predominantly performs de-AMPylation of BiP, enhancing its chaperone activity to handle increased folding demands. Conversely, when unfolded protein burden is low, FICD switches to AMPylation, inactivating BiP.

This system represents a rapid post-translational mechanism for modulating ER chaperone capacity without requiring new protein synthesis, making it an ideal model for studying adaptive stress responses.

What is the relationship between FICD and immune function in zebrafish?

The relationship between FICD and immune function in zebrafish is multifaceted, involving several potential mechanisms:

FICD-RAG protein interactions:

  • STRING interaction data shows connections between FICD and RAG1/RAG2 proteins with interaction scores of 0.556 and 0.560 respectively

  • RAG proteins are critical for V(D)J recombination in developing lymphocytes

  • This connection suggests FICD may influence adaptive immune development

Evolutionary significance:

  • Research on zebrafish has demonstrated RAG-mediated recombination in oocytes, supporting the theory that RAG may have evolved from a transposase that invaded germ cells of ancient species before becoming dedicated to lymphocyte recombination

  • FICD's FIC domain is conserved from bacteria to humans, suggesting ancient evolutionary origins potentially related to immune function

Experimental approaches to study this relationship:

  • Transcriptomic analysis:

    • Compare FICD and immune gene expression across developmental stages

    • Assess changes in FICD expression during immune challenges

  • Immune challenge studies:

    • Evaluate FICD expression and activity during viral or bacterial infection

    • Test if FICD knockdown affects zebrafish survival during immune challenges

    • Examine immune cell development in FICD-deficient zebrafish

  • Recombinant protein studies:

    • Test if recombinant FICD can AMPylate immune-related proteins

    • Investigate if immune stimulation alters FICD enzymatic preferences

Evidence suggests that administration of recombinant immune proteins like IFN1 can protect zebrafish from viral infections , highlighting the importance of recombinant protein studies in understanding immune function. Similar approaches could be applied to investigate FICD's role in immunity.

How do FICD mutations correlate with phenotypic changes in model organisms?

Recent research has begun to uncover correlations between FICD mutations and phenotypic changes, providing insights for zebrafish research:

Human FICD mutations and phenotypes:
A recent study identified a de novo missense variant (c.1295C>T p.Ala432Val) in the FICD gene in a patient with a complex clinical profile including:

  • Borderline intellectual functioning

  • Acanthosis

  • Abdominal muscle hypotonia

  • Anxiety and depression

  • Obesity

  • Optic nerve subatrophy

This mutation occurs in the highly conserved TLLFATTEY region (aa 428-436), suggesting potential impacts on protein function.

Translational research in zebrafish:
To investigate similar mutations in zebrafish, researchers could employ:

  • CRISPR-Cas9 gene editing to introduce equivalent mutations in the zebrafish ficd gene

  • Phenotypic analysis pipeline:

    • Behavioral tests for neurological and anxiety phenotypes

    • Histological examination of muscle development

    • Metabolic assessments for obesity-related phenotypes

    • Optic nerve evaluation

    • Stress response testing

  • Molecular characterization:

    • In vitro enzymatic activity assays comparing wild-type and mutant FICD

    • Protein interaction studies to identify altered binding partners

    • Structural analysis to determine effects on protein conformation

  • Rescue experiments:

    • Test if wild-type human FICD can rescue zebrafish mutant phenotypes

    • Evaluate tissue-specific rescue to identify critical FICD action sites

This translational approach allows researchers to validate findings from human studies in a tractable model organism and elucidate the mechanisms underlying FICD-associated phenotypes.

What techniques can be used to study the temporal dynamics of FICD activity in zebrafish development?

Studying the temporal dynamics of FICD activity during zebrafish development requires sophisticated methodological approaches:

Embryonic expression profiling:

  • Protein profiling throughout embryogenesis using quantitative mass spectrometry can identify FICD expression patterns

  • Comparison with transcriptomics and translatomics datasets provides insights into post-transcriptional regulation

  • Whole-mount in situ hybridization can visualize spatial expression patterns at different developmental stages

Real-time activity monitoring:

  • Biosensor development:

    • FRET-based biosensors that change conformation upon AMPylation

    • Fluorescently labeled substrates that change localization when modified

    • Split-luciferase reporters that assemble upon AMPylation events

  • Live imaging approaches:

    • Two-photon microscopy for deep tissue imaging in developing embryos

    • Light-sheet microscopy for whole-embryo visualization with minimal phototoxicity

    • Time-lapse confocal microscopy for subcellular resolution

Inducible systems for temporal control:

  • Heat-shock promoter-driven FICD expression

  • Chemically-inducible expression systems (e.g., Tet-On/Off)

  • Optogenetic control of FICD activity or expression

Integration with developmental staging:
Correlate FICD activity with key developmental milestones such as:

  • Maternal-to-zygotic transition (MZT)

  • Gastrulation

  • Organogenesis

  • Immune system development

Research has shown that proteins are generally more stable than RNAs during the MZT in zebrafish , suggesting post-translational modifications like AMPylation may play important roles during early development when transcriptional programs are changing rapidly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.