Recombinant Danio rerio Alkaline ceramidase 1 (acer1)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant Danio rerio ACER1 is produced in heterologous expression systems such as E. coli and mammalian cells (e.g., HEK293) . Key features include:

PropertyDetails
UniProt IDQ568I2
Molecular Weight~31 kDa (264 amino acids)
Protein LengthPartial or full-length (1-266 amino acids)
TagHis tag (N-terminal) or untagged, depending on expression system
Purity>85% (SDS-PAGE) or >90% (lyophilized form)
Optimal pHAlkaline (~9.0)

The protein is typically stored in lyophilized or liquid form at -20°C/-80°C, with a shelf life of 6–12 months . Reconstitution involves dissolving in deionized water and adding glycerol (5–50%) for stability .

Functional Role in Ceramide Metabolism

ACER1 regulates sphingolipid balance by converting ceramides into sphingosine, which is further phosphorylated to sphingosine-1-phosphate (S1P) . This activity is critical for:

  • Epidermal differentiation: ACER1-deficient mice exhibit transepidermal water loss and cyclic alopecia due to ceramide accumulation .

  • Antimicrobial defense: Releases sphingoid bases in the stratum corneum to combat pathogens .

  • Cellular stress responses: Modulates apoptosis and proliferation in keratinocytes .

Skin Homeostasis

Acer1-knockout mice showed elevated ceramide levels, disrupted hair shaft cuticles, and impaired skin barrier function, underscoring its role in epidermal integrity . ACER1 expression is upregulated during calcium-induced keratinocyte differentiation, linking it to terminal differentiation pathways .

Intestinal Barrier Function

A 2024 study identified ACER1 as a downstream target of the manganese transporter SLC39A8. Inhibition of ACER1 with D--erythro-MAPP restored sphingomyelin levels and mitigated colitis in Slc39a8-deficient mice, highlighting its role in intestinal epithelial integrity .

Comparative Analysis with Other Ceramidases

CeramidaseOptimal pHLocalizationKey RoleAssociated Diseases
ACER19.0Endoplasmic reticulumSkin barrier formation, differentiationLeukodystrophy, alopecia
ASAH1 (acid)4.5LysosomesCeramide degradationFarber’s disease, cancer
ASAH2 (neutral)7.0–7.4Plasma membraneIntestinal lipid absorptionMetabolic disorders

Applications in Research

  • Disease modeling: Used to study skin disorders and leukodystrophy linked to ceramide dysregulation .

  • Drug development: ACER1 inhibitors like D--erythro-MAPP are explored for inflammatory bowel disease and cancer .

  • Enzyme kinetics: Characterized for substrate specificity toward very-long-chain ceramides .

Challenges and Future Directions

While recombinant ACER1 enables mechanistic studies, its membrane-associated nature complicates purification . Future work may focus on:

  • Structural determination to identify catalytic residues.

  • High-throughput screening for modulators of ACER1 activity.

  • Therapeutic targeting in dermatological and gastrointestinal diseases .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
acer1; asah3; zgc:110285; Alkaline ceramidase 1; AlkCDase 1; Alkaline CDase 1; Acylsphingosine deacylase 3; N-acylsphingosine amidohydrolase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
acer1
Target Protein Sequence
MAGVFSYESSEVDWCEDNYKHSENVVEYFNTMSSFIFFVISPIMLYLLHPYAKERNLAVH LVWIMMVFVGIFSMYFHMTLSFMGQMLDELSILWVLAIGYSLWFPRKHFPSFVKDRTSFA RLVLTITIISTLSSFVKPTANAYALNCFAIHILYSLFVELKSCTDERVLRLAWASIGLWV LAISCWISDRFGCSFWQKLDFCYLHGIWHILIVMATAYASTLIAYLDASQEIPYSLPDLQ YWPRNNWAIGLPYIVLKGTNTTRKTC
Uniprot No.

Target Background

Function
Endoplasmic reticulum ceramidase that catalyzes the hydrolysis of ceramides into sphingosine and free fatty acids at alkaline pH. Ceramides, sphingosine, and its phosphorylated form sphingosine-1-phosphate are bioactive lipids that mediate cellular signaling pathways regulating several biological processes including cell proliferation, apoptosis, and differentiation. This enzyme may also hydrolyze dihydroceramides to produce dihydrosphingosine.
Database Links
Protein Families
Alkaline ceramidase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.