Recombinant Danio rerio Alpha-2A adrenergic receptor (adra2a)

Shipped with Ice Packs
In Stock

Description

Structure and Production

The recombinant adra2a protein is produced via heterologous expression systems, including E. coli, yeast, baculovirus, or mammalian cells . Key structural features include:

  • Molecular Weight: ~49 kDa .

  • Sequence: Full-length protein spanning 388–444 amino acids, with conserved transmembrane domains characteristic of GPCRs .

  • Tags: N-terminal His-tagged versions are available for purification and functional studies .

FeatureDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells .
Purity≥85% (SDS-PAGE validated) .
Storage-20°C or -80°C; avoid repeated freezing/thawing .

Gene and Protein Characteristics

The adra2a gene in Danio rerio encodes a receptor with high sequence homology to mammalian orthologs. Key characteristics include:

AttributeDescription
Uniprot IDQ90WY4 .
Chromosomal LocationNot explicitly reported; inferred from zebrafish genome annotations .
Related ProteinsADRA2B, ADRB3, SLC51B, H2AFB3 (via protein heterodimerization) .

Functional Domains:

  • Epinephrine/Norepinephrine Binding: Critical for receptor activation .

  • G-Protein Coupling: Mediates downstream signaling via MAPK/ERK pathways .

Role in Neurotransmitter Regulation

The alpha-2A adrenergic receptor is implicated in presynaptic inhibition of neurotransmitter release, particularly at high stimulation frequencies . In zebrafish models, adra2a expression is hypothesized to regulate sympathetic nerve activity and stress responses .

Tissue Expression Patterns

While direct data on zebrafish adra2a expression is limited, cross-species studies suggest abundance in:

  • Central Nervous System: Modulation of noradrenergic neurons .

  • Peripheral Tissues: Thyroid, lung, ovary, and adipose tissues .

Genetic and Pharmacological Studies

  • SNP Variants: In humans, ADRA2A polymorphisms (e.g., rs553668) correlate with glucose metabolism and insulin secretion . While zebrafish-specific SNPs are unreported, conserved functional regions suggest analogous roles .

  • Drug Targeting: Recombinant adra2a is used to screen agonists/antagonists for neurological and metabolic disorders .

Antibody Production

Polyclonal antibodies (e.g., rabbit anti-adra2a) enable detection via Western blot and immunofluorescence .

Functional Assays

  • Luciferase Reporter Systems: Measure receptor activation in response to norepinephrine or epinephrine .

  • Compound Screening: Identify ligands with therapeutic potential for hypertension or anxiety .

Comparative Analysis of Recombinant adra2a Products

ParameterDanio rerio adra2a Human ADRA2A
SourceE. coli or cell-free systemsWheat germ or mammalian cells
Tag10xHis-tagNon-tagged or GST/His-tagged
Molecular Weight49 kDa49 kDa
ApplicationsAntibody production, functional studiesDrug discovery, structural studies

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This serves as a reference for your own protocols.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
adra2a; Alpha-2A adrenergic receptor; Alpha-2A adrenoreceptor; Alpha-2A adrenoceptor; Alpha-2AAR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MICGANATNGTNATKEYTLLVALPLSIAVGLLILLIIFGNVLVIIAVFTSRALRAPQNLF LVSLASADILVATLVMPFSLANELMGMWTFGGVWCEIYLALDVLFCTASITHLCAISLDR YWSITQAIEYNLKRTPQRIKRIIFIVWIIAAVISCPPLITMKKSEGDICDINKEKWYIVS SCIGSFFLPCIIMVLVYIRIYQIAKKRTRAPPGDHRKNEVGKKENDPHEKLNGIQNAEPD DKDEINGVDMEESSSSDHKVSNPCSLKKKSSKGKTKLSQIKPGDGDKTEACQTTKASRWK GRQNREKRFTFVLAVVIGVFVICWFPFFFTYTFTAFCDCCVPETLFKFFFWFGYCNSSLN PIIYTIFNNDFRRSFKKILCRRDKRRVV
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The order of potency for this receptor is dexmedetomidine > oxymetazoline = epinephrine > norepinephrine.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2A sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of the Alpha-2A adrenergic receptor in zebrafish?

The Alpha-2A adrenergic receptor (adra2a) in zebrafish is a G protein-coupled receptor with seven transmembrane domains that mediates adrenaline and noradrenaline functions. Like other adrenergic receptors, it contains an extracellular N-terminus, seven transmembrane alpha-helices connected by three intracellular and three extracellular loops, and an intracellular C-terminus domain that interacts with G proteins.

In zebrafish, adra2a functions primarily as a presynaptic autoreceptor that regulates neurotransmitter release from sympathetic nerves and from adrenergic neurons in the central nervous system. Studies have demonstrated that the receptor has a critical role in regulating autonomic functions, nerve output, and sensory integration in the adult zebrafish brain . The activation of adra2a typically inhibits adenylyl cyclase, reducing cAMP levels and subsequently modifying downstream signaling cascades.

Methodologically, to study the basic structure-function relationship, researchers should consider using homology modeling based on crystallized mammalian adrenergic receptors, combined with site-directed mutagenesis experiments to identify critical residues for ligand binding and signal transduction.

How is adra2a distributed throughout the zebrafish brain?

Alpha-2A adrenergic receptors in zebrafish show a distinct anatomical distribution pattern throughout the brain, which has been characterized through immunocytochemistry. The distribution shows both similarities and differences compared to mammalian models.

According to detailed mapping studies, adra2a immunoreactivity is found in multiple cellular components including neuropil, neuronal cell bodies (somata), fibers, glial processes, and blood vessels . The highest density of adra2a is observed in the following regions:

  • Ventral telencephalic area

  • Preoptic regions

  • Pretectal areas

  • Hypothalamic regions

  • Torus semicircularis

  • Oculomotor nucleus (NIII)

  • Locus coeruleus (LC)

  • Medial raphe

  • Medial octavolateralis nucleus (MON)

  • Magnocellular octaval nucleus (MaON)

  • Reticular formation

  • Rhombencephalic nerves and roots

  • Cerebellar Purkinje cell layer

Moderate levels of adra2a expression are found in the medial and central zone nuclei of the dorsal telencephalic area, periventricular gray zone of optic tectum, and in the molecular and granular layers of all cerebellum subdivisions .

For researchers studying adra2a distribution, a combination of immunohistochemistry, in situ hybridization, and transgenic reporter lines would provide comprehensive spatial information about receptor localization.

How does zebrafish adra2a compare with orthologs in other species?

Zebrafish adra2a shares considerable structural and functional homology with its orthologs in other vertebrates, though there are important species-specific differences that researchers should consider when developing experimental models.

Comparative sequence analysis reveals that the zebrafish adra2a protein shares significant amino acid sequence identity with orthologs from other vertebrates. While the exact homology with human ADRA2A is not specified in the provided search results, studies on chicken ADRA2A show 63.4% amino acid sequence identity with its human ortholog . We can infer that zebrafish adra2a would show similar levels of conservation.

The transmembrane domains of adrenergic receptors are generally highly conserved across species, while the intracellular and extracellular loops show greater variability. These differences likely contribute to species-specific signaling properties and ligand binding characteristics.

SpeciesScientific NameAmino Acid LengthKey Structural Features
ZebrafishDanio rerioNot specified in dataG protein-coupled receptor with 7 transmembrane domains
HumanHomo sapiensNot specified in dataG protein-coupled receptor; gene contains no introns
ChickenGallus gallus444 amino acids63.4% identity with human ortholog
MouseMus musculusReferenced but details not providedRequired for presynaptic control of transmitter release

Methodologically, researchers studying comparative aspects should perform comprehensive phylogenetic analyses and functional assays across species to determine conserved regulatory mechanisms and species-specific adaptations in adrenergic signaling.

What are the experimental challenges in expressing and purifying recombinant zebrafish adra2a?

Working with recombinant zebrafish adra2a presents several experimental challenges that researchers must address through careful methodological approaches:

  • Membrane Protein Expression: As a seven-transmembrane G protein-coupled receptor, adra2a is inherently difficult to express in heterologous systems. The hydrophobic nature of transmembrane domains often leads to protein misfolding, aggregation, or improper trafficking.

    Solution: Researchers should optimize expression systems specifically for membrane proteins, such as insect cell lines (Sf9, High Five) with baculovirus vectors, or mammalian expression systems (HEK293, CHO) that contain appropriate chaperones and post-translational modification machinery.

  • Protein Stability: Maintaining the native conformation of adra2a during purification is challenging due to the requirement for a lipid environment.

    Solution: Employ detergent screening to identify optimal solubilization conditions. Consider using lipid nanodiscs, styrene-maleic acid lipid particles (SMALPs), or amphipols to maintain the protein in a near-native lipid environment.

  • Functional Verification: Ensuring that recombinant adra2a retains its functional properties is critical.

    Solution: Implement multiple functional assays including ligand binding studies, G protein coupling assays, and downstream signaling measurements using cAMP assays or MAPK/ERK activity monitoring, similar to methods used for chicken ADRA2A characterization .

  • Species-Specific Modifications: Zebrafish-specific post-translational modifications may affect receptor function.

    Solution: Compare expression in fish cell lines versus mammalian systems, and characterize any differences in glycosylation or phosphorylation patterns.

A methodological approach combining these solutions would involve systematic optimization of expression constructs, including testing different affinity tags (His, FLAG, etc.) positioned at either N- or C-terminus, and carefully evaluating the impact of these modifications on receptor function through detailed pharmacological characterization.

How do genetic variations in zebrafish adra2a affect receptor function and signaling?

Genetic variations in zebrafish adra2a can significantly impact receptor function and downstream signaling pathways. While zebrafish-specific data is limited in the search results, insights can be drawn from studies of adra2a variants in other species:

In human studies, several ADRA2A variants (rs10885122, rs553668, and rs1800544) have been associated with altered glucose regulation, particularly in stress conditions . The rs553668 variant, located in the 3′-UTR of ADRA2A, affects mRNA expression levels and receptor density, resulting in enhanced α2A-AR activity and altered insulin secretion .

For zebrafish adra2a research, investigators should:

  • Identify natural polymorphisms in zebrafish populations through sequencing efforts

  • Create targeted mutations using CRISPR/Cas9 in key functional domains based on homology with human variants

  • Characterize these variants through comprehensive signaling assays

The functional impact of genetic variations should be assessed at multiple levels:

Level of AnalysisMethodological ApproachExpected Outcomes
Receptor ExpressionqRT-PCR, Western blottingChanges in mRNA and protein levels
Ligand BindingRadioligand binding assaysAltered binding affinity (Kd) or receptor density (Bmax)
G Protein Coupling[35S]GTPγS binding assaysModified G protein activation efficiency
Downstream SignalingcAMP assays, MAPK/ERK phosphorylationChanges in signaling cascade dynamics
Physiological FunctionBehavioral assays, glucose tolerance testsAltered physiological responses

A particularly valuable approach would be to recreate human disease-associated variants in the zebrafish ortholog and assess their functional impact, creating translational models for human conditions associated with adra2a dysfunction.

How does adra2a interact with different signal transduction pathways in zebrafish neurons?

Adra2a in zebrafish neurons interacts with multiple signal transduction pathways, similar to its orthologs in other species. While the search results don't provide zebrafish-specific data on all pathways, we can infer likely mechanisms based on available information:

Researchers investigating zebrafish adra2a signaling should consider these pathways:

  • Gαi/o-mediated Inhibition of Adenylyl Cyclase:

    • Methodology: Measure changes in cAMP levels using ELISA or FRET-based sensors in response to adra2a agonists and antagonists

    • Expected outcome: Decreased cAMP production upon receptor activation

  • MAPK/ERK Signaling Cascade:

    • Methodology: Monitor ERK1/2 phosphorylation via Western blot or phospho-specific antibodies following receptor stimulation

    • Evidence: Chicken ADRA2A activates MAPK/ERK signaling , suggesting conservation of this pathway

  • Ion Channel Modulation:

    • Methodology: Electrophysiological recordings to measure changes in calcium or potassium currents

    • Focus: Particular attention to G protein-coupled inwardly rectifying potassium channels (GIRKs)

  • β-arrestin-dependent Signaling:

    • Methodology: Assess β-arrestin recruitment and internalization dynamics using fluorescently tagged proteins

    • Importance: May reveal biased signaling properties of different ligands

What expression systems are optimal for producing functional recombinant zebrafish adra2a?

Selecting the appropriate expression system is crucial for producing functional recombinant zebrafish adra2a. Based on available data and best practices for GPCR expression, researchers should consider these systems:

  • Mammalian Expression Systems:

    • HEK293 and CHO cells are widely used for GPCR expression due to their human-like post-translational modifications

    • These systems support proper folding and trafficking of membrane proteins

    • Methodology: Use strong promoters (CMV, EF1α) with codon-optimized sequences for enhanced expression

    • Advantage: Suitable for functional studies as they contain G proteins and downstream signaling machinery

  • Insect Cell Systems:

    • Sf9 or High Five cells with baculovirus expression vectors provide high protein yields

    • Methodology: Optimize infection conditions (MOI, time of harvest) for balance between quantity and quality

    • Consideration: May lack some mammalian post-translational modifications but generally produce correctly folded GPCRs

  • Yeast Expression Systems:

    • Pichia pastoris offers advantages for structural studies requiring large protein quantities

    • Methodology: Use alpha-factor signal sequence for proper membrane targeting

    • Limitation: Different lipid composition might affect receptor conformation

  • Cell-Free Expression Systems:

    • Emerging option for rapid screening of conditions

    • Methodology: Supplement with lipids or nanodiscs to support membrane protein folding

    • Advantage: Avoids cellular toxicity issues that might occur with overexpression

Based on studies with other adrenergic receptors, a comprehensive approach would involve:

Expression SystemOptimal ApplicationKey Optimization Parameters
HEK293TFunctional assays, ligand screeningTransfection efficiency, expression time
Sf9/BaculovirusProtein purification for structural studiesVirus titer, harvest timing, temperature
Stable cell linesLong-term studies, consistent protein sourceSelection pressure, clonal selection

For zebrafish adra2a specifically, researchers might consider fish cell lines (e.g., ZF4) for expression studies to maintain species-specific post-translational modifications and membrane environments.

What techniques are most effective for studying adra2a distribution and trafficking in zebrafish neurons?

Investigating the distribution and trafficking of adra2a in zebrafish neurons requires a combination of imaging techniques and molecular approaches. Based on previous studies and current methodologies, the following techniques are most effective:

  • Immunohistochemistry and Immunocytochemistry:

    • Has been successfully used to map adra2a distribution in zebrafish brain

    • Methodology: Use validated antibodies against zebrafish adra2a with appropriate controls

    • Advantage: Allows visualization of endogenous receptor in fixed tissue

    • Enhancement: Combine with cell-type specific markers to identify expressing neurons

  • Fluorescent Protein Tagging:

    • Methodology: Generate constructs with adra2a fused to fluorescent proteins (GFP, mCherry)

    • Application: Particularly useful for studying receptor trafficking in live neurons

    • Implementation: Use minimal tags or split-fluorescent protein approaches to minimize functional interference

  • CRISPR Knock-in Approaches:

    • Methodology: Generate zebrafish lines with endogenously tagged adra2a

    • Advantage: Maintains native expression levels and regulatory control

    • Consideration: Verify that the tag doesn't interfere with receptor function

  • Super-resolution Microscopy:

    • Techniques: STORM, PALM, or STED microscopy for nanoscale resolution

    • Application: Resolving receptor clusters and membrane microdomains

    • Methodology: Combine with proximity ligation assays to detect protein interactions

  • RNA Visualization Techniques:

    • Methods: In situ hybridization or RNAscope for mRNA localization

    • Utility: Complement protein studies to understand transcriptional regulation

    • Enhancement: Combine with transcriptome analysis across developmental stages

For trafficking studies specifically, researchers should consider:

MethodApplicationMethodological Consideration
FRAP (Fluorescence Recovery After Photobleaching)Membrane mobility dynamicsRequires live imaging setup with controlled temperature
pH-sensitive GFP variants (pHluorin)Internalization and recyclingTags should be positioned in extracellular domains
Pulse-chase experimentsReceptor turnover ratesCombine with endosomal markers for trafficking pathway analysis
Transgenic lines with inducible expressionTemporal control of expressionUse tissue-specific or conditional promoters

The high density of adra2a immunoreactivity found in specific brain regions suggests that region-specific analysis would be particularly valuable for understanding specialized functions in different neural circuits.

How can functional assays be optimized to characterize recombinant zebrafish adra2a activity?

Optimizing functional assays for recombinant zebrafish adra2a requires careful consideration of the receptor's signaling pathways and pharmacological properties. Based on the available data and established methodologies for adrenergic receptors, the following assays should be considered:

  • Ligand Binding Assays:

    • Methodology: Saturation binding with radiolabeled ligands (e.g., [³H]-yohimbine) to determine Kd and Bmax

    • Enhancement: Competition binding with various agonists and antagonists to establish selectivity profiles

    • Consideration: Membrane preparation quality is critical; optimize conditions for zebrafish adra2a specifically

  • G Protein Coupling Assays:

    • Methodology: [³⁵S]GTPγS binding assay to measure G protein activation

    • Application: Quantifies the first step in receptor signaling cascade

    • Enhancement: Use immunoprecipitation with G protein subtype-specific antibodies to determine coupling preferences

  • cAMP Modulation Assays:

    • Methodology: ELISA-based detection or real-time FRET sensors (e.g., EPAC-based)

    • Consideration: As adra2a primarily couples to Gαi/o, measure inhibition of forskolin-stimulated cAMP production

    • Optimization: Establish dose-response relationships for both agonists and antagonists

  • MAPK/ERK Pathway Activation:

    • Methodology: Western blot analysis of ERK1/2 phosphorylation or FRET-based reporters

    • Evidence: ADRA2A has been shown to activate MAPK/ERK signaling in other species

    • Optimization: Time-course experiments to capture both rapid and sustained signaling events

  • Electrophysiological Assays:

    • Methodology: Patch-clamp recording of GIRK channel activity in expression systems

    • Application: Provides direct measurement of a physiologically relevant downstream effect

    • Enhancement: Combine with neuron-specific promoters in primary zebrafish neuronal cultures

A comprehensive characterization would include pharmacological profiling:

Assay TypeKey Parameters to MeasureSuggested Controls
Agonist profilingEC₅₀, Emax, rank order potencyInclude reference agonists (e.g., norepinephrine, epinephrine)
Antagonist profilingIC₅₀, Kb values, competitive vs. non-competitiveInclude selective antagonists (e.g., yohimbine, BRL-44408)
Allosteric modulator screeningEffect on agonist potency and efficacyTest known adra2a modulators from mammalian systems

For zebrafish-specific optimization, researchers should:

  • Determine optimal temperature conditions (considering zebrafish are poikilothermic)

  • Compare receptor behavior in mammalian vs. fish cell backgrounds

  • Evaluate species-specific differences in ligand selectivity

How should researchers interpret expression data for adra2a across different zebrafish developmental stages?

Interpreting expression data for adra2a across zebrafish developmental stages requires rigorous analytical approaches and contextual understanding. While the search results don't provide zebrafish-specific developmental expression data, the methodological approach can be informed by studies of adra2a in other species and general principles of developmental gene expression analysis.

When analyzing developmental expression patterns, researchers should:

  • Normalize Data Appropriately:

    • Methodology: Use multiple reference genes validated for stability across developmental stages

    • Implementation: Apply geometric averaging of reference genes using algorithms like geNorm or NormFinder

    • Consideration: Different normalization may be needed for different developmental periods

  • Employ Statistical Approaches for Temporal Patterns:

    • Methodology: Time-series analysis to identify significant changes between consecutive stages

    • Application: Calculate rate of change (differential expression) between stages

    • Enhancement: Cluster analysis to identify co-regulated genes sharing expression patterns with adra2a

  • Integrate with Anatomical Data:

    • Methodology: Combine quantitative expression data with spatial information from in situ hybridization

    • Implementation: Create spatiotemporal maps of expression

    • Consideration: Expression level changes may reflect either changes in cell-specific expression or changes in the proportion of expressing cells

  • Consider Paralog Compensation:

    • Methodology: Simultaneously analyze expression of all adrenergic receptor subtypes

    • Rationale: Zebrafish genome duplication may have created functional redundancy

    • Application: Calculate relative abundance of each receptor subtype at each stage

Based on RNA-Seq analysis approaches described for chicken ADRA2A , researchers can quantify adra2a expression as transcripts per million (TPM) across developmental stages and tissues. A sample data presentation format would be:

Developmental StageBrain TPMHeart TPMLiver TPMOther Tissues TPM
24 hpf(value)(value)(value)(value)
48 hpf(value)(value)(value)(value)
72 hpf(value)(value)(value)(value)
Larval stage(value)(value)(value)(value)
Juvenile(value)(value)(value)(value)
Adult(value)(value)(value)(value)

Interpretation should consider that adra2a expression may correlate with the development of specific neural circuits, particularly those involving regions with high adra2a density in adults (ventral telencephalic area, locus coeruleus, etc.) . Changes in expression should be interpreted in the context of known developmental milestones for these neural systems.

What are the key considerations when analyzing ligand binding data for recombinant zebrafish adra2a?

Analyzing ligand binding data for recombinant zebrafish adra2a requires careful attention to methodological details and appropriate data interpretation. Researchers should consider these key factors:

  • Saturation Binding Analysis:

    • Methodology: Use increasing concentrations of a selective radioligand (e.g., [³H]-yohimbine) until saturation

    • Key Parameters: Calculate dissociation constant (Kd) and maximum binding capacity (Bmax)

    • Quality Control: Ensure adequate separation of specific from non-specific binding (at least 3:1 ratio)

    • Implementation: Use non-linear regression to fit data to one-site or two-site binding models

  • Competition Binding Analysis:

    • Methodology: Displace a fixed concentration of radioligand with increasing concentrations of unlabeled compounds

    • Key Parameters: Calculate inhibition constant (Ki) using the Cheng-Prusoff equation

    • Implementation: Analyze hill slopes to detect potential allosteric interactions or multiple binding sites

    • Consideration: Include known ADRA2A ligands (both agonists and antagonists) as reference compounds

  • Species-Specific Considerations:

    • Methodology: Compare binding profiles with human or rodent ADRA2A to identify zebrafish-specific properties

    • Application: Identify ligands with differential selectivity across species

    • Implementation: Calculate selectivity ratios for various ligands across species orthologs

  • Data Visualization and Statistical Analysis:

    • Methodology: Present data as saturation curves, Scatchard plots, and competition curves

    • Statistics: Apply appropriate statistical tests for comparing binding parameters

    • Replication: Ensure adequate biological and technical replicates (minimum n=3)

Sample data representation for binding parameters:

LigandKi (nM) for Zebrafish adra2aHill CoefficientKi (nM) for Human ADRA2ASelectivity Ratio
Norepinephrine(value)(value)(value)(value)
Epinephrine(value)(value)(value)(value)
Yohimbine(value)(value)(value)(value)
BRL-44408(value)(value)(value)(value)
Clonidine(value)(value)(value)(value)

Researchers should be mindful that ligand binding properties may be influenced by:

  • The expression system used for recombinant production

  • The membrane environment (detergent, lipid composition)

  • The presence or absence of G proteins and other signaling partners

  • Temperature and buffer conditions (especially relevant for a poikilothermic species like zebrafish)

For structure-function analysis, correlate binding data with molecular modeling based on the known antagonists of ADRA2A, including atipamezole, idazoxan, and yohimbine , to identify key residues that may differ between zebrafish and mammalian orthologs.

How can researchers resolve contradictory findings in zebrafish adra2a functional studies?

Resolving contradictory findings in zebrafish adra2a functional studies requires a systematic approach to identify sources of variability and reconcile apparently conflicting results. Researchers should implement the following methodological strategies:

  • Systematic Analysis of Experimental Variables:

    • Methodology: Create a comprehensive table comparing key experimental parameters across contradictory studies

    • Parameters to compare: Expression systems, protein constructs, assay conditions, reagents used

    • Implementation: Identify critical differences that might explain divergent results

    • Application: Design controlled experiments that systematically vary these parameters

  • Reproducibility Assessment:

    • Methodology: Replicate key experiments using standardized protocols

    • Implementation: Establish inter-laboratory validation if possible

    • Consideration: Calculate statistical power to ensure adequate sample sizes

    • Application: Use blinded analysis to minimize bias

  • Reconciliation Approaches for Functional Data:

    • Methodology: Consider receptor states and coupling efficiency

    • Implementation: Evaluate data in context of receptor state models (active, inactive, intermediate)

    • Application: Assess functional selectivity/biased signaling as potential explanation

    • Consideration: Different assays may detect different aspects of receptor function

  • Genetic and Post-translational Variation Analysis:

    • Methodology: Sequence verification of constructs used across studies

    • Implementation: Evaluate potential differences in post-translational modifications

    • Application: Consider background genetic variation in zebrafish lines

    • Reference: Human ADRA2A genetic variants have been shown to affect receptor function

A structured approach to evaluating contradictory findings might include:

AspectAnalysis MethodResolution Strategy
Pharmacological discrepanciesStandardized dose-response curvesDirect comparison using identical compounds and assay conditions
Expression level variationsQuantitative comparison of receptor densityNormalize functional data to expression levels
Signaling pathway differencesPathway-specific inhibitorsMap complete signaling networks to identify divergence points
Model system variationsCompare in vitro vs. in vivo findingsBridge studies using ex vivo preparations

When presenting reconciled data, researchers should:

  • Explicitly acknowledge contradictions in the literature

  • Present side-by-side comparisons of divergent findings

  • Provide a unified model that accounts for apparent contradictions

  • Suggest testable hypotheses for remaining unexplained discrepancies

For zebrafish adra2a specifically, contradictions might arise from temperature-dependent effects (relevant for poikilothermic species), developmental differences in receptor coupling efficiency, or the presence of unidentified receptor variants. The observation that adra2a is expressed in multiple cell types in zebrafish brain, including neurons and glial processes , suggests that cell type-specific factors might contribute to functional heterogeneity.

What are the emerging techniques for studying zebrafish adra2a in neural circuit function?

Emerging techniques for studying zebrafish adra2a in neural circuit function combine the advantages of zebrafish as a model organism with cutting-edge neuroscience methods. Researchers should consider these advanced approaches:

  • Optogenetic Manipulation of adra2a-Expressing Neurons:

    • Methodology: Express channelrhodopsin or halorhodopsin in adra2a-positive neurons using CRISPR knock-in or transgenic approaches

    • Application: Precisely activate or silence these neurons while monitoring circuit activity

    • Enhancement: Combine with behavioral assays to link circuit activity to function

    • Advantage: Leverages zebrafish transparency for whole-brain imaging

  • Chemogenetic Approaches:

    • Methodology: Express Designer Receptors Exclusively Activated by Designer Drugs (DREADDs) in adra2a-expressing cells

    • Application: Modulate adra2a-positive neuronal activity with temporal precision

    • Implementation: Adapt mammalian DREADDs for zebrafish use, ensuring functionality

    • Advantage: Allows manipulation of specific neural populations without direct light access

  • Calcium Imaging of adra2a-Modulated Circuits:

    • Methodology: Express GCaMP in specific neural circuits while manipulating adra2a function

    • Application: Visualize how adra2a activation or inhibition affects circuit-wide calcium dynamics

    • Enhancement: Use volumetric imaging techniques for whole-brain activity mapping

    • Reference: High adra2a expression in regions like locus coeruleus suggests important circuit modulation

  • Connectomic Analysis:

    • Methodology: Map connections of adra2a-expressing neurons using trans-synaptic tracers

    • Application: Understand how these neurons integrate into larger networks

    • Implementation: Combine with serial electron microscopy for ultrastructural analysis

    • Advantage: Zebrafish larvae permit whole-brain connectomic analysis

  • In vivo Biosensors for adra2a-Mediated Signaling:

    • Methodology: Develop FRET-based or intensiometric sensors for downstream signaling pathways

    • Application: Real-time visualization of adra2a activity in intact circuits

    • Implementation: Target sensors to different cellular compartments (membrane, cytosol)

    • Enhancement: Combine with optogenetic stimulation for input-output analysis

A methodological workflow might include:

TechniquePrimary Data OutputIntegration with Other Methods
Cell type-specific RNA-seqTranscriptomic profile of adra2a-expressing cellsIdentify molecular targets for manipulation
CRISPR-based fluorescent taggingVisualization of native adra2a expressionTarget optogenetic tools to expressing cells
Fiber photometryActivity patterns of adra2a neuronal populationsCorrelate with behavioral outputs
Selective pharmacologyReceptor-specific modulationCombine with calcium imaging for circuit effects

The high density of adra2a in regions like the locus coeruleus and raphe nuclei suggests a particular focus on monoaminergic modulation of zebrafish neural circuits, with potential relevance to stress responses, arousal, and attention.

How might computational approaches advance our understanding of zebrafish adra2a structure and function?

Computational approaches offer powerful tools to advance our understanding of zebrafish adra2a structure and function, providing insights that would be difficult to obtain through experimental methods alone. Researchers should consider these advanced computational strategies:

  • Homology Modeling and Molecular Dynamics:

    • Methodology: Build zebrafish adra2a structural models based on crystallized mammalian adrenergic receptors

    • Application: Use extended molecular dynamics simulations to study receptor dynamics

    • Implementation: Incorporate membrane environment with appropriate lipid composition

    • Enhancement: Model different receptor states (active, inactive, intermediate)

  • Virtual Screening and Rational Drug Design:

    • Methodology: Use docking approaches similar to those employed for structure-based design of ADRA2A antagonists

    • Application: Identify zebrafish-selective compounds or species differences in ligand binding

    • Implementation: Include water molecules and flexible residues in binding site

    • Enhancement: Validate predictions with experimental binding assays

  • Systems Biology Modeling:

    • Methodology: Develop mathematical models of adra2a signaling networks

    • Application: Predict system-level responses to receptor modulation

    • Implementation: Incorporate data from multiple experimental approaches

    • Enhancement: Use sensitivity analysis to identify key regulatory nodes

  • Machine Learning for Pattern Recognition:

    • Methodology: Apply deep learning to analyze complex datasets from adra2a studies

    • Application: Identify subtle phenotypic effects of receptor variants

    • Implementation: Train algorithms on large behavioral datasets

    • Enhancement: Use unsupervised learning to discover novel behavioral patterns

  • Phylogenetic Analysis and Evolutionary Modeling:

    • Methodology: Compare adra2a sequences across vertebrate evolution

    • Application: Identify conserved functional domains and species-specific adaptations

    • Implementation: Use selection pressure analysis to highlight functionally important residues

    • Reference: Compare to other species where adra2a has been characterized

A computational workflow might include:

Computational ApproachData InputExpected Insight
Sequence-based predictionZebrafish adra2a primary sequenceKey functional motifs and potential phosphorylation sites
Binding site analysisHomology model + known ligandsSpecies-specific binding pocket differences
Molecular dynamicsFull receptor structure in membraneConformational changes during activation
Network modelingExperimental signaling dataSystem-level response to partial agonists

For zebrafish adra2a specifically, computational approaches should focus on:

  • Predicting the functional impact of differences between zebrafish and mammalian orthologs

  • Modeling temperature-dependent effects on receptor dynamics (relevant for a poikilothermic species)

  • Simulating how the unique distribution pattern in zebrafish brain influences neural circuit function

  • Predicting ligand selectivity based on binding pocket analysis, potentially guiding the design of zebrafish-selective compounds

These computational approaches would complement experimental studies, generating testable hypotheses and providing mechanistic explanations for experimental observations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.