Recombinant Danio rerio ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Danio rerio ATP synthase subunit a (mt-atp6) is a mitochondrial protein encoded by the mt-atp6 gene, which plays a critical role in oxidative phosphorylation. This subunit forms part of the proton-translocating F₀ sector of ATP synthase (Complex V), facilitating proton transport across the inner mitochondrial membrane and coupling it to ATP synthesis . In zebrafish (Danio rerio), the protein is evolutionarily conserved, sharing structural and functional similarities with human and other eukaryotic homologs .

Key Properties:

PropertyDetails
Uniprot IDQ9MIY5
Gene Namemt-atp6
Protein Length227 amino acids (full-length)
FunctionProton channel subunit in ATP synthase; essential for ATP production
Expression HostsE. coli, yeast, baculovirus, mammalian cells

Role in ATP Synthase

As part of the F₀ subunit, mt-atp6 collaborates with subunit A6L (encoded by mt-atp8) to stabilize the c-ring and enable proton flow . This process drives the rotation of the central stalk, coupling proton translocation to ATP synthesis in the F₁ sector .

Expression Systems

The recombinant protein is produced via heterologous expression in multiple systems:

HostAdvantagesNotes
E. coliHigh yield, cost-effectiveHis-tagged protein for affinity purification
YeastEukaryotic post-translational modificationsUsed in functional studies of mtDNA variants
MammalianNative-like folding and glycosylationLimited scalability; niche applications

Purification and Quality Control

  • Purity: >90% as verified by SDS-PAGE .

  • Buffer: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles .

Functional Studies

Recombinant mt-atp6 has been used to model human mitochondrial diseases:

  1. Pathogenic Mutations: Yeast models expressing mt-atp6 variants (e.g., m.9025G>A, m.9029A>G) showed impaired ATP synthase assembly and reduced oxidative phosphorylation .

  2. Proton Channel Dynamics: Studies in E. coli and yeast highlighted mt-atp6’s role in stabilizing the F₀-F₁ complex and enabling proton translocation .

Disease Relevance

While mt-atp6 mutations in humans cause neuropathies (e.g., NARP syndrome), the zebrafish recombinant protein serves as a tool to study:

  • Mitochondrial Dysfunction: Impaired ATP production linked to neurodegenerative diseases .

  • Heteroplasmy Effects: Impact of mutant mtDNA on ATP synthase activity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
Target Protein Sequence
MMTSFFDQFASPYLLGIPLILVAMLLPWLLFPAPTSRWINNRLITVQTWLTGRFTNQLMT PLNFSGHKWALLFASLMVFLITINLLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMKN QPTIALGHLLPEGTPIPLIPALIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVF VLLPMMPAVAILTASVLFLLTLLEVAVAMIQAYVFILLLSLYLQENI
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is created by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of mt-atp6 in the mitochondrial ATP synthase complex?

Mt-atp6 functions as a critical component of mitochondrial Complex V (CV), specifically forming part of the ATP synthase proton channel. This subunit is encoded by the mitochondrial genome and plays an essential role in the proton pumping mechanism that drives ATP synthesis. The protein forms part of the membrane-embedded Fo domain of ATP synthase, where it helps create the pathway for protons to flow down their electrochemical gradient, thereby driving the rotational catalysis that generates ATP in the F1 domain .

Research has demonstrated that the mt-atp6 subunit is particularly important for maintaining proper proton conductance. Pathogenic variants in this gene can result in either increased or decreased mitochondrial membrane potential, indicating its crucial role in regulating proton flow across the inner mitochondrial membrane . The protein's function is highly conserved across species, making zebrafish an excellent model for studying its properties.

How does heteroplasmy affect mt-atp6 function in research models?

Heteroplasmy—the presence of both wild-type and variant mitochondrial DNA within cells—significantly impacts the phenotypic expression of mt-atp6 variants. Meta-analysis of reported clinical data has demonstrated that heteroplasmy load correlates significantly with disease severity, with symptomatic individuals showing statistically higher heteroplasmy levels compared to asymptomatic carriers (p=3.2×10^-45) .

When designing zebrafish models with mt-atp6 variants, researchers should consider the following methodological approaches:

  • Quantify heteroplasmy levels using techniques such as next-generation sequencing, pyrosequencing, or digital PCR

  • Establish a correlation between heteroplasmy percentage and phenotypic severity

  • Track heteroplasmy levels across generations to assess mitochondrial bottleneck effects

  • Consider tissue-specific heteroplasmy patterns, as different tissues may show variable levels

Research has shown that heteroplasmy threshold effects exist, where clinical symptoms typically manifest only above certain percentages of variant mtDNA. This threshold varies depending on the specific variant, with some pathogenic variants causing disease at lower heteroplasmy levels than others .

What conservation patterns of mt-atp6 should inform experimental design?

The evolutionary conservation of mt-atp6 provides crucial insights for experimental design when working with recombinant proteins. Conservation analysis reveals that different regions of the protein show varying degrees of evolutionary constraint:

MutationConservation PatternSIFT ScoreFunctional Implication
m.8573G>A p.Gly16AspConserved in primates0.01 (damaging)Potential disruption of protein function
m.8608C>T p.Pro28SerConserved in humans0.41 (tolerated)Less likely to disrupt function
m.8612T>C p.Leu29ProConserved in mammals0.03 (damaging)Likely to affect protein function
m.8723G>T p.Arg66LeuConserved in vertebrates0.20 (tolerated)Potentially tolerated change
m.8843T>C p.Ile106ThrConserved in mammals0.03 (damaging)Likely functional consequence

When designing recombinant Danio rerio mt-atp6 constructs, researchers should:

  • Identify highly conserved residues across species, particularly those conserved in vertebrates

  • Use conservation data to inform mutagenesis studies

  • Consider the functional domains when designing truncated proteins

  • Compare zebrafish mt-atp6 sequence with human counterparts to establish translational relevance

What are the optimal expression systems for producing functional recombinant mt-atp6?

Producing functional recombinant mt-atp6 presents significant challenges due to its hydrophobic nature and mitochondrial origin. Based on research with related ATP synthase components, the following expression systems can be considered:

  • Yeast Expression Systems: Yeast models (particularly S. cerevisiae) have proven effective for expressing mitochondrial proteins, including ATP synthase components. The similarity in mitochondrial translation machinery makes yeast suitable for mt-atp6 expression .

  • Bacterial Expression Systems: While challenging due to the lack of mitochondrial post-translational modification machinery, E. coli systems can be optimized for mt-atp6 expression by:

    • Using specialized strains designed for membrane protein expression

    • Employing fusion partners that enhance solubility

    • Optimizing codon usage for bacterial expression

  • Cell-Free Expression Systems: These can circumvent toxicity issues sometimes encountered with membrane proteins.

  • Mammalian Cell Expression: HEK293 or similar cell lines may provide appropriate post-translational modifications.

When pursuing expression in any system, researchers should consider:

  • Including affinity tags that minimally interfere with function

  • Implementing inducible expression systems to control protein levels

  • Measuring ATP synthase activity to confirm functionality of the recombinant protein

What biochemical assays are most informative for characterizing recombinant mt-atp6 function?

Based on established research protocols for ATP synthase components, several biochemical assays provide valuable functional data for recombinant mt-atp6:

  • ATP Synthesis Rate Measurement: This direct measure of ATP synthase function is critical, as pathogenic variants in mt-atp6 primarily affect ATP synthesis rather than hydrolysis. Methodology involves:

    • Isolating mitochondria or reconstituted proteoliposomes

    • Measuring ATP production using luciferase-based assays

    • Comparing synthesis rates with different substrates (malate vs. succinate)

  • Proton Pumping Assays: Since mt-atp6 forms part of the proton channel, assessing proton flux is essential:

    • Monitoring mitochondrial membrane potential using fluorescent dyes (e.g., TMRM, JC-1)

    • Measuring pH changes across membranes

    • Assessing oligomycin sensitivity, a specific inhibitor of ATP synthase

  • Complex Assembly Analysis:

    • Blue native PAGE to assess incorporation into the ATP synthase complex

    • Immunoprecipitation to evaluate interactions with other subunits

    • Sucrose gradient centrifugation to determine complex integrity

Research has demonstrated that different mt-atp6 variants exhibit distinct biochemical profiles. For example, some variants show decreased ATP synthesis with preserved ATP hydrolysis, while others may affect both functions . This highlights the importance of comprehensive biochemical characterization.

How can antibacterial properties of ATP synthase subunits inform mt-atp6 research?

Recent research has identified unexpected antibacterial properties in ATP synthase components that may prove relevant for mt-atp6 studies. In zebrafish, the ATP synthase α subunit (ATP5A1) has been characterized as a pattern recognition receptor capable of binding bacterial components and exerting direct antibacterial effects .

When investigating potential antibacterial properties of recombinant mt-atp6, researchers should consider:

  • Bacterial Membrane Interaction Assays:

    • Membrane depolarization measurements

    • Membrane permeabilization assays

    • Direct binding studies with bacterial membrane components

  • Structure-Function Analysis:

    • In ATP5A1, the N-terminal 65 residues were identified as critical for antibacterial activity

    • Similar domain mapping in mt-atp6 could reveal functional regions

    • Truncation mutants can help identify active domains

  • In Vivo Verification:

    • Microinjection of recombinant protein into zebrafish embryos

    • Challenge with pathogenic bacteria (e.g., Aeromonas hydrophila)

    • Quantification of bacterial load and embryo survival

The conservation of antibacterial properties across ATP synthase components suggests this may be an ancestral function worth exploring in mt-atp6, potentially revealing novel therapeutic applications.

How should researchers interpret contradictory data when assessing mt-atp6 variant pathogenicity?

Determining the pathogenicity of mt-atp6 variants presents significant challenges due to heterogeneous biochemical findings. When confronted with apparently contradictory data, researchers should implement the following analysis framework:

  • Systematic Meta-analysis Approach:

    • Compile comprehensive data across multiple biochemical parameters

    • Calculate the frequency of abnormal findings for each parameter

    • Identify patterns specific to certain variants or variant classes

  • Variant-Specific Biochemical Signatures:

    • Different mt-atp6 variants can produce opposing biochemical effects

    • For example, m.8993T>G typically increases mitochondrial membrane potential

    • In contrast, m.9185T>C typically decreases membrane potential

    • These opposite findings are not contradictory but reflect different mechanisms of pathogenicity

  • Integrated Analysis Framework:

Biochemical ParameterInterpretation of Abnormal FindingsComplementary Assays
ATP synthesis rateDirect measure of functional impactATP hydrolysis, oligomycin sensitivity
Mitochondrial membrane potentialIndicates proton pumping efficiencyProton leak assays
ATP hydrolysisLess sensitive for mt-atp6 variantsATP synthesis, assembly analysis
CV holoenzyme assemblyStructural impact assessmentBN-PAGE, immunoprecipitation

Research demonstrates that no single biochemical marker is universally abnormal across all pathogenic mt-atp6 variants, necessitating a multi-parameter approach to interpretation .

What statistical approaches best analyze heteroplasmy-phenotype correlations in mt-atp6 research?

When analyzing the relationship between heteroplasmy levels and phenotypic outcomes in mt-atp6 research, several statistical approaches have proven effective:

  • Population-Level Analysis:

    • T-tests comparing heteroplasmy levels between symptomatic and asymptomatic individuals

    • Meta-analysis has shown significant differences (p=3.2×10^-45) between these groups

  • Threshold Effect Modeling:

    • Logistic regression to identify heteroplasmy thresholds for symptom onset

    • Receiver operating characteristic (ROC) curves to determine optimal diagnostic thresholds

    • Bayesian models to account for tissue-specific heteroplasmy variation

  • Phenotype Severity Correlation:

    • Ordinal regression models linking heteroplasmy to disease severity

    • Research shows correlation between heteroplasmy level and phenotype severity

    • Early-onset phenotypes like Leigh Syndrome typically show higher heteroplasmy than later-onset NARP syndrome

  • Tissue-Specific Analysis:

    • Mixed-effects models accounting for tissue-specific heteroplasmy

    • Correlation of tissue-specific heteroplasmy with organ-specific symptoms

    • Consideration of mitotic segregation effects in different tissues

When implementing these approaches, researchers should be aware of potential confounding factors such as nuclear genetic background, mitochondrial haplogroup, and environmental influences that may modify the heteroplasmy-phenotype relationship.

How can sequence conservation analysis guide mt-atp6 variant classification?

Evolutionary conservation analysis provides crucial information for interpreting the functional significance of mt-atp6 variants. A structured approach to conservation analysis should include:

  • Multi-level Conservation Assessment:

    • Determine conservation across taxonomic levels (primates, mammals, vertebrates)

    • Variants affecting residues conserved across vertebrates are more likely pathogenic

    • Conservation in distantly related species suggests fundamental functional importance

  • Integrated Variant Classification Framework:

Conservation LevelSIFT ScoreAdditional EvidenceClassification Guidance
Primates only>0.05 (tolerated)Normal biochemistryLikely benign
Mammals<0.05 (damaging)Abnormal ATP synthesisLikely pathogenic
Vertebrates<0.05 (damaging)Clinical correlationPathogenic
Not conserved>0.05 (tolerated)High population frequencyBenign
  • Functional Domain Context:

    • Evaluate whether variants affect known functional domains

    • Mutations in proton channel regions have greater impact than peripheral areas

    • Structural modeling can predict the impact on protein-protein interactions

  • Population Frequency Calibration:

    • Compare variant frequency in reference databases to expected disease prevalence

    • High frequency variants (like m.8843T>C with 155/45,494 frequency) are less likely pathogenic

    • Rare variants absent from population databases warrant greater scrutiny

By combining conservation analysis with biochemical data and clinical information, researchers can more accurately classify mt-atp6 variants according to ACMG criteria.

How can translational regulation studies of mt-atp6 inform recombinant protein design?

Recent discoveries regarding translational regulation of mt-atp6 provide important insights for recombinant protein design and expression strategies. Research has revealed sophisticated regulatory mechanisms controlling mt-atp6 expression:

  • Coordination with Nuclear-Encoded Subunits:

    • Translation of mitochondrial ATP8/ATP6 mRNA is regulated by F1 ATPase availability

    • This ensures coordination between mitochondrial and nuclear genetic systems

    • When designing expression systems, consider co-expression of interacting subunits

  • Repressor-Based Regulation:

    • Dmt1p (previously Smt1p) acts as a translational repressor of ATP8/ATP6 mRNA

    • F1 ATPase weakens the Dmt1p-mRNA interaction, allowing translation

    • This mechanism prevents accumulation of unassembled subunits that could depolarize mitochondria

  • Transcript-Specific Activation:

    • Atp22p is a transcript-specific translational activator for ATP8/ATP6 mRNA

    • It competes with the repressor when F1 ATPase is available

    • Similar factors may be needed for optimal recombinant expression

Based on these findings, researchers working with recombinant mt-atp6 should consider:

  • Co-expression with appropriate assembly partners

  • Regulated expression systems that mimic natural control mechanisms

  • Inclusion of specific translational enhancers in expression constructs

This understanding of translational regulation may explain challenges in expressing functional mt-atp6 and suggests strategies to overcome them.

What approaches can differentiate between primary functional defects and secondary consequences in mt-atp6 variants?

Distinguishing primary functional defects from secondary consequences presents a significant challenge in mt-atp6 research. A methodological framework to address this includes:

  • Comprehensive Biochemical Profiling:

    • Measure multiple parameters: ATP synthesis, hydrolysis, membrane potential, complex assembly

    • Identify the earliest detectable abnormality in time-course experiments

    • Compare findings across multiple cell types or tissues

  • Mechanistic Classification System:

VariantPrimary DefectSecondary ConsequencesMechanistic Classification
m.8993T>GIncreased membrane potentialDecreased ATP synthesisImpaired proton conductance
m.9176T>GDecreased ATP synthesisNormal response to oligomycinImpaired proton pumping efficiency
m.9185T>CDecreased membrane potentialVariable ATP hydrolysisUnregulated proton leak
  • Rescue Experiments:

    • Express wild-type mt-atp6 in affected systems

    • Determine which abnormalities are corrected directly versus indirectly

    • Use specific inhibitors to distinguish primary from secondary effects

  • Structural Biology Approach:

    • Generate structural models of mt-atp6 variants

    • Identify altered interactions with other subunits

    • Correlate structural predictions with biochemical findings

Research has demonstrated that pathogenic mt-atp6 variants can affect ATP synthase through distinct mechanisms, including disrupted proton pumping efficiency, impaired complex assembly, or altered sensitivity to regulatory molecules .

What novel functions of mt-atp6 beyond ATP synthesis warrant investigation?

The discovery of unexpected functions in ATP synthase components suggests potential novel roles for mt-atp6 that deserve exploration:

  • Potential Immunological Functions:

    • ATP synthase α subunit (ATP5A1) in zebrafish functions as a pattern recognition receptor

    • It binds bacterial components like lipoteichoic acid and lipopolysaccharide

    • Similar binding properties could exist in mt-atp6, particularly in exposed domains

  • Direct Antimicrobial Activity:

    • ATP5A1 exhibits direct antibacterial effects through membrane disruption

    • The mechanism involves both membrane depolarization and permeabilization

    • The N-terminal region (residues 1-65) of ATP5A1 is critical for this activity

    • Analogous regions in mt-atp6 may possess similar properties

  • Developmental Regulation:

    • ATP5A1 is abundantly stored in zebrafish eggs and embryos

    • It provides protection against bacterial infection during early development

    • Mt-atp6 may have parallel roles in early embryonic protection or development

  • Evolutionary Conservation of Novel Functions:

    • The antibacterial activity of ATP5A1 is conserved throughout animal evolution

    • This suggests these are ancestral functions that may be present in mt-atp6

    • Comparative studies across species could reveal conservation of non-canonical functions

These potential novel functions expand our understanding of mitochondrial proteins beyond their canonical roles in energy production and warrant systematic investigation in recombinant mt-atp6 research.

What strategies can overcome challenges in functional assessment of recombinant mt-atp6?

Functional assessment of recombinant mt-atp6 presents several technical challenges that can be addressed through the following methodological approaches:

  • Overcoming Membrane Protein Expression Difficulties:

    • Use specialized expression systems designed for membrane proteins

    • Consider cell-free expression systems to avoid toxicity

    • Employ fusion partners that enhance stability and solubility

    • Optimize codon usage for the expression system

  • Addressing Functional Assay Limitations:

ChallengeSolution StrategyMethodological Consideration
Low signal-to-noise in ATP synthesis assaysReconstitute into proteoliposomesEnsure proper orientation in membrane
Variable membrane potential measurementsStandardize with ionophore controlsUse ratiometric dyes for quantification
Distinguishing mt-atp6 function from other subunitsSite-directed mutagenesis of key residuesCompare with characterized variants
Complex assembly assessmentCombine BN-PAGE with activity assaysInclude assembly factor supplementation
  • Improving Protein Stability:

    • Add stabilizing lipids during purification

    • Optimize buffer conditions (pH, ionic strength)

    • Consider nanodiscs or amphipol technology for membrane protein stabilization

    • Use mild detergents that preserve functionality

Research on mt-atp6 variants has employed multiple complementary approaches to overcome these challenges, as no single assay provides complete functional assessment .

How can researchers reconcile contradictory findings in heteroplasmy threshold studies?

Contradictory findings regarding heteroplasmy thresholds for mt-atp6 variants can be reconciled through several methodological approaches:

By implementing these approaches, researchers can develop more accurate models of the relationship between heteroplasmy and phenotypic expression for specific mt-atp6 variants.

What quality control measures ensure reproducibility in recombinant mt-atp6 research?

Ensuring reproducibility in recombinant mt-atp6 research requires rigorous quality control measures throughout the experimental workflow:

  • Protein Expression and Purification Quality Controls:

    • Validate protein identity by mass spectrometry

    • Confirm proper folding through circular dichroism

    • Assess homogeneity via size exclusion chromatography

    • Verify membrane integration using flotation assays

  • Functional Validation Checklist:

Quality Control ParameterMethodologyAcceptance Criteria
ATP synthesis activityLuciferase-based assayActivity comparable to native complex
Proton conductanceMembrane potential measurementAppropriate response to inhibitors
Protein-protein interactionsCo-immunoprecipitationInteraction with known partners
Structural integrityLimited proteolysisProtection of key functional domains
  • Experimental Design Considerations:

    • Include appropriate positive and negative controls

    • Blind analysis where possible

    • Perform biological replicates across multiple preparations

    • Use multiple complementary assays for key findings

  • Data Reporting Standards:

    • Report comprehensive methods details for replication

    • Include raw data availability

    • Specify exact buffer compositions and reaction conditions

    • Document software versions and analysis parameters

Research on mt-atp6 variants has demonstrated the importance of these quality control measures, as single assays may yield incomplete or misleading results without proper validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.