Recombinant Danio rerio Bombesin receptor-activated protein C6orf89 homolog (zgc:162255)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zgc:162255; Bombesin receptor-activated protein C6orf89 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
zgc:162255
Target Protein Sequence
MGSSLSEPCIYDKLSESIDILRQSGYRYGMSEREIEKFIKQVLETNEPRREPPQFPILRA TVKFVVAVGVVLMAVLVFTYPQSPVLMGSVSGTTLNNSSPLSHIRLLELPIAEKYNLHGF HEWWASSSLQTMDLNCSACTDVTDILELTDQLRTSAGEHTRTQPLLLKGGAALSLRVSQM DQFSSVSQTPANFTLLWSVSSRPRESVLQWLFPESERCPLLEIWSSTLQRCRLSSRRPQP SRVQVLGWMVVADGSPDVRLLPVQRCRKHCRSFSLRLEPGDMVFADSQIWLMELSPSGAQ DVQCDSAVL
Uniprot No.

Target Background

Function

This protein exhibits histone deacetylase (HDAC) enhancer properties and may play a role in cell cycle progression.

Database Links

KEGG: dre:100037321

UniGene: Dr.139310

Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein. Cytoplasm.

Q&A

What is the evolutionary relationship between Danio rerio Bombesin receptor-activated protein and its homologs in other vertebrates?

The bombesin receptor system in Danio rerio must be understood within the broader evolutionary context of bombesin-like peptides across vertebrates. Bombesin was originally isolated from frog skin as an antibacterial peptide, and bombesin-like peptides function through G protein-coupled receptors (GPCRs) . The orthologous relationships among gastrin-releasing peptide (GRP), neuromedin B (NMB), bombesin, and their receptors show interesting evolutionary patterns.

Synteny analysis of genes surrounding bombesin-related genes in Xenopus tropicalis, Nanorana parkeri, Microcaecilia unicolor, Rhinatrema bivittatum, Danio rerio, and Homo sapiens reveals high conservation in gene order . This conservation suggests that bombesin and NMB are respective orthologs, with specialization occurring in specific lineages. For Danio rerio specifically, the synteny of genes surrounding GRP genes shows high conservation with both Xenopus tropicalis and Homo sapiens .

The phylogenetic classification indicates that while some diversification has occurred in certain lineages (like the specialization of NMB to bombesin in frogs), the GRP and GRPR systems are widely conserved across vertebrates including zebrafish . This conservation suggests fundamental biological roles for these signaling systems that have been maintained throughout vertebrate evolution.

What expression systems are most effective for producing recombinant Danio rerio Bombesin receptor-activated protein?

When expressing recombinant Danio rerio proteins, the choice of expression system significantly impacts yield, folding, and functionality. Based on recombinant protein production principles, several options should be considered:

Yeast Expression Systems:
Yeast systems like Pichia pastoris offer eukaryotic protein processing capabilities while maintaining relatively high yields . This system may be advantageous when the native protein requires disulfide bond formation or simple glycosylation patterns.

Insect Cell Expression:
The baculovirus expression system using insect cells provides more complex post-translational modifications and often produces properly folded vertebrate proteins . This system represents a middle ground between simpler prokaryotic systems and more complex mammalian cell cultures.

Mammalian Cell Expression:
For the most authentic post-translational modifications and proper folding, mammalian cell expression (typically HEK293 or CHO cells) is recommended, especially if the protein will be used in functional studies . This approach is particularly relevant for receptor-related proteins that require specific glycosylation patterns.

The optimal expression strategy should be determined based on the intended application of the recombinant protein. For structural studies, bacterial or yeast systems may be sufficient, while functional characterization might necessitate mammalian expression to preserve native receptor properties.

What purification challenges are specific to Danio rerio Bombesin receptor-associated proteins?

Purification of Danio rerio bombesin receptor-associated proteins presents several specific challenges:

Membrane Association:
As bombesin receptors are G protein-coupled receptors (GPCRs), associated proteins often have hydrophobic domains or membrane-interacting regions . These characteristics necessitate careful detergent selection during extraction and purification to maintain protein solubility without denaturing critical structural elements.

Protein Stability:
Many receptor-associated proteins demonstrate limited stability once removed from their native membrane environment. Researchers should implement stability screens to identify optimal buffer conditions (pH, salt concentration, additives) that maintain protein integrity throughout purification .

Co-purifying Contaminants:
Zebrafish proteins expressed in heterologous systems may co-purify with host cell proteins, particularly if they form complexes with endogenous proteins in the expression system. Multiple orthogonal purification steps are recommended to achieve high purity:

Purification StepPrincipleAdvantagesConsiderations
IMAC (His-tag)Metal affinityHigh capacity, simpleBackground binding
Size exclusionMolecular sizeSeparates aggregates, preserves complexesSample dilution
Ion exchangeSurface chargeHigh resolutionSalt sensitivity
Affinity chromatographySpecific bindingHigh selectivityLigand cost, elution conditions

Verification of Functionality:
For receptor-associated proteins, structural integrity alone is insufficient; verification of functional activity is essential. Developing activity assays appropriate for the specific protein is crucial for confirming that the purified protein retains its native properties.

How can I design experiments to investigate the functional relationship between Danio rerio Bombesin receptor-activated protein and signaling pathways?

Investigating functional relationships between the Danio rerio bombesin receptor-activated protein and downstream signaling requires a multi-faceted experimental approach:

Co-immunoprecipitation Studies:
To identify protein-protein interactions, co-immunoprecipitation experiments can reveal direct binding partners. This approach has been successfully used to demonstrate interactions between other receptor systems, such as the TSH receptor (TSHR) and CD40 protein . For the zebrafish bombesin receptor system, similar approaches could identify whether the C6orf89 homolog physically interacts with the bombesin receptor or with components of downstream signaling cascades.

Phosphorylation Analysis:
As receptor activation typically triggers phosphorylation cascades, phospho-specific antibodies or phosphoproteomics approaches can map signaling events. Western blotting for phosphorylated proteins following stimulation with bombesin can reveal temporal activation patterns . For example, in studies of EGFR signaling, researchers tracked EGFR phosphorylation levels in the presence or absence of specific ligands to elucidate signaling dynamics .

Genetic Manipulation Strategies:
CRISPR/Cas9-mediated gene editing or morpholino knockdown in zebrafish models provides powerful tools for investigating protein function in vivo. By creating loss-of-function models, researchers can assess developmental phenotypes and altered signaling responses. These approaches are particularly valuable in zebrafish due to the model's transparency during development and amenability to genetic manipulation.

Transcriptional Profiling:
RNA-seq analysis before and after stimulation of bombesin receptors can identify genes whose expression changes in response to receptor activation. This approach can map the broader transcriptional consequences of bombesin signaling and potentially identify new functional connections.

Live Imaging:
For real-time analysis of signaling dynamics, fluorescent reporter constructs can be developed. FRET-based sensors designed to detect specific protein interactions or second messenger production (such as calcium flux or cAMP) can provide spatial and temporal resolution of signaling events following receptor activation.

What are the most reliable methods for characterizing post-translational modifications of recombinant Danio rerio Bombesin receptor-activated protein?

Characterizing post-translational modifications (PTMs) of recombinant proteins requires sophisticated analytical techniques:

Mass Spectrometry-Based Approaches:
Liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) provides the most comprehensive characterization of PTMs. For the Danio rerio bombesin receptor-activated protein, the following MS approaches are recommended:

Site-Specific Analysis of Glycosylation:
If the protein is glycosylated, specialized techniques are required:

  • PNGase F treatment: Removes N-linked glycans for separate analysis

  • Glycopeptide enrichment: Improves detection of modified peptides

  • Glycan profiling: Characterizes released glycan structures

Phosphorylation Analysis:
For phosphorylation sites:

  • Phospho-enrichment using TiO₂ or IMAC: Increases detection sensitivity

  • Phospho-specific antibodies: Verifies specific phosphorylation sites

  • Phosphatase treatment: Confirms phosphorylation vs. other modifications

It's essential to compare PTMs on recombinant protein with those on the native protein whenever possible, as expression systems may produce different modification patterns . This comparison helps ensure that the recombinant protein accurately represents the native zebrafish protein.

How can contradictory functional data about Danio rerio Bombesin receptor systems be reconciled in research contexts?

When faced with contradictory data regarding bombesin receptor systems in Danio rerio, researchers should apply several analytical strategies:

Methodological Differences Analysis:
Systematically compare experimental conditions between contradictory studies, including:

  • Expression systems used (bacterial, yeast, insect, mammalian)

  • Protein constructs (full-length vs. truncated, fusion tags)

  • Buffer compositions and assay conditions

  • Detection methods and their sensitivity limits

Receptor Subtype Specificity:
Bombesin-like peptides function through multiple receptor subtypes including GRP-preferring receptor (GRPR or BB2), NMB-preferring receptor (NMBR or BB1), and bombesin receptor subtype-3 (BRS-3 or BB3) . Contradictory results may stem from differential receptor activation or expression. Creating a detailed comparison table of receptor-specific responses can help identify patterns:

Receptor SubtypeLigand SpecificitySignaling PathwayExpression PatternFunctional Response
GRPR (BB2)GRP > BombesinPrimarily Gq/11Brain, spinal cordAutonomic functions
NMBR (BB1)NMB > BombesinGq/11 and othersVaried by tissueSmooth muscle contraction
BRS-3 (BB3)Orphan/Low affinityMultiple pathwaysRestrictedLess characterized

Evolutionary Context Consideration:
Contradictions may reflect genuine biological diversity across vertebrate lineages. The evolutionary analysis of bombesin-related systems shows both conservation and specialization . Consider whether differences reflect:

  • Species-specific adaptations

  • Paralog-specific functions after gene duplication

  • Developmental stage-specific regulation

Integrated Data Analysis:
Apply computational approaches to integrate contradictory datasets:

  • Meta-analysis of multiple studies

  • Bayesian inference to determine most probable mechanisms

  • Network modeling to identify context-dependent regulation

When publishing such analyses, researchers should explicitly acknowledge contradictions in the literature and present a framework for understanding contextual factors that may explain different experimental outcomes.

What controls are essential when studying recombinant Danio rerio Bombesin receptor-activated protein expression patterns across tissues?

When characterizing expression patterns of bombesin receptor-activated proteins across zebrafish tissues, rigorous controls are essential:

RNA-level Expression Controls:
For RT-PCR or RNA-seq studies, the following controls are mandatory:

  • Housekeeping gene normalization: Consistently expressed genes such as GAPDH should be amplified from all tissue RNA preparations to confirm RNA quality and proper reverse transcription . In studies of bombesin-related genes in Xenopus, GAPDH served as an internal control to confirm RNA integrity across tissues .

  • Primer specificity verification: Genomic DNA controls and melt curve analysis ensure primers amplify only the intended target, particularly important when studying gene families with high sequence similarity.

  • No-template and no-RT controls: These exclude contamination and genomic DNA amplification.

Protein-level Expression Controls:

  • Loading controls: Total protein normalization (Ponceau staining) or housekeeping proteins ensure equal loading across tissue samples.

  • Antibody validation: Preabsorption tests, knockout/knockdown samples, or recombinant protein standards verify antibody specificity. This is particularly important when studying protein families with similar epitopes.

  • Subcellular fractionation controls: When examining membrane-associated proteins, fraction purity markers confirm proper separation of cellular compartments.

Cross-validation Between Methods:
Agreement between RNA and protein detection methods strengthens confidence in expression patterns. For zebrafish bombesin receptor systems, both in situ hybridization and immunohistochemistry would provide complementary spatial information about expression patterns.

Developmental Stage Considerations:
For developmental studies, precise staging and temporal sampling are critical. Contradictory results may emerge from slight differences in developmental timing.

What are the optimal experimental conditions for functional assays of Danio rerio Bombesin receptor-activated protein?

Establishing optimal conditions for functional assays requires systematic optimization of multiple parameters:

Buffer Composition Optimization:
The functional activity of bombesin receptor-activated proteins depends significantly on buffer conditions:

Buffer ComponentRange to TestConsiderations
pH6.5-8.0Test at 0.5 unit intervals
NaCl50-300 mMIonic strength affects protein-protein interactions
Divalent cations0-10 mM Mg²⁺, Ca²⁺Many receptors require specific cations
Reducing agents0-5 mM DTT/BMETest if disulfide bonds affect function
DetergentsVarious, below CMCFor membrane-associated proteins

Temperature and Incubation Time:
Zebrafish proteins may show temperature optima different from mammalian homologs:

  • Test activity at 28°C (zebrafish physiological temperature)

  • Compare with activity at 37°C (mammalian assay standard)

  • Establish time-course to determine linear range of assay

Ligand Concentration Range:
For receptor-activated proteins, dose-response relationships should be established:

  • Wide concentration range (10⁻¹⁰ to 10⁻⁵ M) for initial characterization

  • Narrower ranges around EC₅₀ for detailed studies

  • Include both GRP and bombesin as potential ligands, as affinity differences have been observed across species

Detection System Sensitivity:
Ensure the detection method has appropriate:

  • Dynamic range covering expected signal changes

  • Signal-to-noise ratio allowing reliable quantification

  • Temporal resolution for kinetic studies

Positive and Negative Controls:
Essential controls include:

  • Known activators and inhibitors of the pathway

  • Inactive protein variants (e.g., site-directed mutants)

  • Competing peptides to demonstrate specificity

For interaction studies between bombesin receptors and associated proteins, co-immunoprecipitation approaches similar to those used for other receptor systems can be adapted, with appropriate controls for antibody specificity and binding conditions.

What strategies can address the challenges of producing sufficient quantities of properly folded recombinant Danio rerio Bombesin receptor-activated protein?

Producing adequate quantities of correctly folded recombinant protein requires addressing several common challenges:

Optimization of Expression Conditions:
Systematic optimization includes:

  • Induction parameters: For bacterial systems, test IPTG concentration (0.1-1.0 mM), temperature (16-37°C), and induction duration (2-24 hours)

  • Growth media supplements: Addition of rare codons, chaperone co-expression, or osmolytes

  • Cell density at induction: Optimize OD₆₀₀ for induction (typically 0.6-0.8)

Protein Solubility Enhancement:
For proteins prone to aggregation:

  • Fusion tags: Solubility enhancing partners (MBP, SUMO, thioredoxin)

  • Co-expression with binding partners: Expression with natural interaction partners can improve folding

  • Refolding protocols: If inclusion bodies form, develop optimized refolding protocols with gradual denaturant removal

Scale-up Strategies:
For higher yield requirements:

  • High-density fermentation: Controlled feeding strategies in bioreactors

  • Perfusion culture: For mammalian expression systems

  • Transient vs. stable expression: Evaluate trade-offs between speed and consistency

Construct Design Considerations:

  • Domain boundaries: Express individual domains if full-length protein is problematic

  • Codon optimization: Adapt to expression host preference

  • Signal sequence optimization: Improve translocation for secreted variants

Quality Control Metrics:
Implement rigorous quality assessment:

  • Thermal shift assays: Monitor protein stability across conditions

  • Size exclusion chromatography: Assess aggregation state

  • Activity assays: Confirm functional integrity

For membrane-associated proteins like bombesin receptors and their partners, expression with appropriate detergents or lipid environments may be critical for maintaining native conformation . Approaches similar to those used for other receptor-associated proteins in case studies can be adapted specifically for the zebrafish bombesin receptor system .

How does the function of Danio rerio Bombesin receptor-activated protein compare with its homologs in other model organisms?

Comparative functional analysis of bombesin receptor systems across vertebrates reveals both conserved and divergent features:

Evolutionary Conservation Patterns:
The bombesin/GRP receptor system shows significant conservation across vertebrate lineages. Synteny analysis of genes surrounding GRP genes demonstrates high conservation among Danio rerio, Xenopus tropicalis, and Homo sapiens . This conservation suggests fundamental biological roles that have been maintained throughout vertebrate evolution.

  • In amphibians, bombesin was originally identified as an antibacterial peptide in frog skin, with higher binding affinity for bombesin than for either GRP or NMB .

  • In mammals, bombesin-like peptides function via three G protein-coupled receptors: GRP-preferring receptor (GRPR/BB2), NMB-preferring receptor (NMBR/BB1), and bombesin receptor subtype-3 (BRS-3/BB3) .

  • In zebrafish and other teleosts, the repertoire of bombesin receptors shows both conservation and lineage-specific adaptations.

Functional Conservation Assessment:
Across vertebrates, the GRP system is involved in various autonomic-related functions including:

  • Food intake regulation

  • Circadian rhythm control

  • Fear memory consolidation

  • Reproductive function

  • Control of sighing

  • Itch sensation

Comparative studies should examine whether the Danio rerio homolog participates in these same processes or has evolved zebrafish-specific functions. Evidence from expression patterns can provide initial insights—for example, in Xenopus, GRP mRNA is highly expressed in the brain, spinal cord, and stomach, with weaker expression in the lung . Similar expression analyses in zebrafish would indicate potential functional conservation.

Receptor-Ligand Specificity Differences:
Sequence analysis reveals that while the carboxyl-terminus regions of GRP, NMB, and bombesin peptides are quite similar (with 4 amino acids—W, A, G, M—conserved across these peptides), the signal peptide region and carboxyl-terminal extension peptide region are diversified between GRP, NMB, and bombesin, and also between different animals . These differences likely contribute to species-specific signaling properties.

What bioinformatic approaches best predict structure-function relationships for Danio rerio Bombesin receptor-activated protein?

Modern bioinformatic tools offer powerful approaches for predicting protein structure and function:

Sequence-Based Predictions:

  • Multiple sequence alignment (MSA): Aligning the Danio rerio protein with homologs from diverse vertebrates identifies conserved residues likely crucial for function. Special attention should be paid to residues conserved across all vertebrates versus those conserved only within specific lineages .

  • Motif identification: Tools like MEME and PROSITE can identify functional motifs such as binding sites, post-translational modification sites, and localization signals.

  • Disorder prediction: Identifying intrinsically disordered regions using tools like PONDR or IUPred helps distinguish structured domains from flexible linkers.

Structure Prediction Approaches:

  • AlphaFold2/RoseTTAFold: These AI-based tools now provide near-experimental quality structural models, particularly valuable for proteins without experimental structures.

  • Comparative modeling: When homologs have known structures, tools like SWISS-MODEL can generate reliable models based on template structures.

  • Domain boundary identification: Tools like DomPred help define functional units within multi-domain proteins.

Functional Annotation Methods:

  • Gene Ontology (GO) mapping: Transferring GO terms from well-characterized homologs provides initial functional hypotheses.

  • Protein-protein interaction prediction: Tools like STRING integrate multiple evidence sources to predict interaction partners.

  • Ligand binding site prediction: Computational approaches like CASTp and SiteMap can identify potential binding pockets.

Integrative Approaches:
The most powerful predictions come from integrating multiple methods:

  • Combining evolutionary conservation, structural features, and physicochemical properties to identify functional sites

  • Correlating expression patterns with predicted functions

  • Network-based approaches to place the protein in broader biological contexts

For the Danio rerio bombesin receptor-activated protein specifically, comparative analysis with other vertebrate C6orf89 homologs would be particularly informative for generating testable hypotheses about its specific role in bombesin receptor signaling.

How can I design experiments to validate predicted functional domains in Danio rerio Bombesin receptor-activated protein?

Validating predicted functional domains requires a strategic experimental approach:

Site-Directed Mutagenesis Strategy:
Based on bioinformatic predictions, design mutations targeting:

  • Conserved residues: Mutate amino acids conserved across species to test their necessity for function

  • Predicted binding sites: Alter residues in putative protein-protein or protein-ligand interfaces

  • Post-translational modification sites: Mutate predicted phosphorylation, glycosylation, or other modification sites

Design both conservative mutations (maintaining similar physicochemical properties) and non-conservative mutations to distinguish between structural and functional roles.

Domain Deletion and Swapping:

Protein-Protein Interaction Validation:

  • Co-immunoprecipitation: Similar to approaches used for other receptor systems , validate physical interactions between bombesin receptors and the C6orf89 homolog

  • Proximity labeling: Techniques like BioID or APEX can identify interaction partners in living cells

  • FRET/BRET assays: Measure direct interactions in real-time with tagged proteins

Functional Rescue Experiments:

  • Knockdown/knockout complementation: Test whether mutated proteins can rescue loss-of-function phenotypes

  • Cross-species complementation: Determine if homologs from other vertebrates can substitute functionally

Structural Validation:

  • Limited proteolysis: Map domain boundaries through differential protease sensitivity

  • HDX-MS (Hydrogen-Deuterium Exchange): Identify regions with differential solvent accessibility upon binding

  • Crosslinking mass spectrometry: Map interaction interfaces at amino acid resolution

For each experimental approach, appropriate controls must be included:

  • Wild-type protein controls to establish baseline function

  • Expression-matched mutants to ensure differences aren't due to expression levels

  • Specificity controls to confirm that observed effects are specific to the targeted domain

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.