Recombinant Danio rerio C3a anaphylatoxin chemotactic receptor (c3ar1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2065230
Source
in vitro E.coli expression system
Synonyms
c3ar1; C3a anaphylatoxin chemotactic receptor; C3AR; C3a-R
Quick Inquiry

Description

Key Functional Domains

  • Ligand Binding: The N-terminal region binds C3a, triggering downstream signaling .

  • Signaling: Coupled to G-proteins, activating pathways such as phosphatidylinositol phospholipase C (PLC) and calcium mobilization .

Immune Modulation in Teleost Fish

The c3ar1 receptor regulates immune responses in zebrafish and related species:

  1. Phagocytosis Enhancement: C3a signaling via c3ar1 stimulates phagocytic activity in B cells and leukocytes, critical for pathogen clearance .

  2. Inflammation Regulation: Modulates chemotaxis, granule enzyme release, and superoxide production, balancing immune defense and tissue damage .

  3. Complement System Cross-Talk: Interacts with C3a-derived peptides and other anaphylatoxins (e.g., C5a) in immune cascades .

Phagocytosis-Stimulating Activity

Studies in grass carp and rainbow trout demonstrate that C3a receptor activation enhances phagocytosis:

Model OrganismExperimental ApproachOutcome
Grass carpGST-C3a.1 (recombinant C3a) + anti-c3ar1 antibodiesPhagocytosis inhibited by antibody blockade
Rainbow troutC-terminal C3a peptide (C3a.1-CP)Enhanced phagocytosis in head kidney leukocytes (HKLs)
ZebrafishRecombinant c3ar1 + C3a ligand bindingLigand-dependent activation confirmed via Western blot and binding assays

Use Cases

  1. Immunology Research: Studying C3a-receptor interactions in teleost immunity, including vaccine adjuvant development .

  2. Drug Discovery: Screening inhibitors of C3aR1 to modulate inflammation in zebrafish models of disease .

  3. Structural Biology: Crystallization studies to map ligand-receptor interactions .

Limitations

  • Low Solubility: Recombinant c3ar1 often requires refolding or stabilizing tags for functional studies .

  • Species-Specific Tools: Limited availability of anti-zebrafish c3ar1 antibodies compared to mammalian systems .

Future Research

  1. Therapeutic Targeting: Investigating c3ar1 inhibitors to treat inflammatory diseases in zebrafish models .

  2. Evolutionary Studies: Comparing c3ar1 function across teleost species to elucidate complement system divergence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
c3ar1; C3a anaphylatoxin chemotactic receptor; C3AR; C3a-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
c3ar1
Target Protein Sequence
MQQETQAPPLLLLYARSISKTNYIFRVSAMDENYENFTDAYEEMWGFDANETNTFASSEV RVISLVVYCLTFLLGVPGNSFVIFIAGMKMKRTVNTIWFLNLATADLLCCLSVPLTVAEI LLDHHWPYGYAMCKILPSVIVISMFASVFTLNIISLDRFTQVITPVWAQNHRSLLLARLS CVAVWILALLLSLPFMILRRTYEEFNMTVCTFDDDDFTTYGALSIVRFVFGFLIPLMSIV TCYGIIARKLGSRHFRSGRAFRIMLAVIVAFFLCWMPYHVLDLIRSYGGESSSMVALKVD PLAISLAYVNSCLNPVLYVFMGQDFKNKVQLSLRRVFERAFSEEGTQISRSTQSQQVHSV L
Uniprot No.
P0C7U4

Target Background

Function

Function: The Danio rerio C3a anaphylatoxin chemotactic receptor (c3ar1) is a receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. Activation of this receptor stimulates chemotaxis, granule enzyme release, and superoxide anion production.

Database Links

STRING: 7955.ENSDARP00000040270

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.