Recombinant Danio rerio Calcitonin gene-related peptide type 1 receptor (calcrla)

Shipped with Ice Packs
In Stock

Description

Introduction and Basic Characteristics

AttributeValue
SourceDanio rerio (Zebrafish)
Host SystemE. coli or mammalian cells (e.g., HEK293)
TagHis-tag (determined during production)
Protein LengthPartial (24–470 amino acids) or full-length (mature protein)
Storage BufferTris-based buffer, 50% glycerol
Purity>85% (SDS-PAGE verified)
ApplicationsELISA, functional assays, receptor-ligand interaction studies

Data synthesized from .

Role in Zebrafish Vascular Development

calcrla (crlr) is indispensable for arterial specification and angiogenesis. Key findings include:

Vascular Development Pathways

ProcessMechanismOutcome
Arterial IdentityRegulates ephrin-B2a, DeltaC, and notch5 expressionLoss of arterial markers in crlr morphants
Vascular Endothelial Growth Factor (VEGF)Upregulates VEGF expression; vegf overexpression rescues arterial defectsRestores dorsal aorta integrity
Sonic Hedgehog (SHH) SignalingSHH regulates crlr expression in somitesAlters vascular patterning

Data from .

Key Phenotypes in crlr-Deficient Zebrafish

  • Dorsal Aorta: Atrophic trunk and interrupted anterior bifurcation.

  • Intersomitic Vessels: Delayed development.

  • Blood Circulation: Absent due to venous-arterial identity loss .

Involvement in Calcium Homeostasis

calcrla interacts with the calcitonin (CT)/CGRP peptide family to regulate ion balance. In zebrafish:

  • CGRP Receptor: CRLR1 (calcrla) binds CGRP, distinct from CT receptor (CTR) .

  • High-Calcium Stress Response:

    • CT/CTR Upregulation: Mitigates hypercalcemia via hypocalcemic activity.

    • ECaC Downregulation: Reduces epithelial calcium channel expression .

Peptide-Receptor Specificity

LigandReceptor ComplexFunction
CGRPCRLR1-RAMP1Vasodilation, neurogenic inflammation
AdrenomedullinCRLR1-RAMP2/3Vascular smooth muscle relaxation

Based on .

Research Applications and Production

calcrla is produced for functional studies, ELISA assays, and receptor-ligand interaction mapping.

Production Parameters

ParameterValue
Expression HostE. coli (full-length) or mammalian cells (partial)
Yield50 µg standard; bulk quantities available
Storage-20°C/-80°C in Tris-glycerol buffer; avoid freeze-thaw cycles
Stability6 months (liquid), 12 months (lyophilized)

Specifications from .

Comparative Analysis of Receptor Complexes

calcrla exhibits conserved and divergent features compared to mammalian CGRP receptors:

FeatureZebrafish calcrlaHuman CALCRL
RAMP PartnerRAMP1 (CGRP), RAMP2/3 (adrenomedullin)RAMP1 (CGRP), RAMP2/3 (adrenomedullin)
Tissue ExpressionCNS, somites, axial vesselsCNS, cardiovascular, immune systems
Pathway InvolvementSHH-VEGF-notch (vascular)GPCR signaling (cAMP/PKA)

Comparative data from .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, keep working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
calcrla; calcrl; si:dkey-249o24.2; zgc:100872; Calcitonin gene-related peptide type 1 receptor; CGRP type 1 receptor; Calcitonin receptor-like receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-470
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
calcrla
Target Protein Sequence
SPEVNESQQQHPQNVYHDIGVTRNKIVTAQFECYQKIMKDNSQDRRGPVCNRTWDGWLCW DDTEAGITSEQHCPDYFQDFDPTEMVTKICTESGQWFLHPESNRTWTNFTRCNLHTTEGR RTAMNLFYLALIGHGLSLTSLFISLGIFFHFKSLSCQRITLHKNLFFSFVLNSIITIIWL TAVANNQELVQQNPISCKISQFIHLYIFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWY YLLGWGFPLIPATIHAVARSYYYNDNCWISSNTSLLYIIHGPICAAMLVNLFFLLNIVRV LITKLKVTHQAKSSLYMKAVRATLILVPLLGIQYVLLPYKPSGRVSAEIYDYIMHILMHY QGLLVATIFCFFNGEVQAVLRRHWNQYRIQFGSTITQSDALRSASYTASSITEVQGCYSI DGHTEHLNGKNYHDFDNAIIKPENPFA
Uniprot No.

Target Background

Function
Calcitonin gene-related peptide type 1 receptor (calcrla) is a receptor for calcitonin-gene-related peptide (CGRP) in Danio rerio (zebrafish). Receptor specificity may be modulated by accessory proteins. The activity of this receptor is mediated by G proteins that activate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the calcitonin gene-related peptide type 1 receptor (calcrla) in Danio rerio?

The calcitonin gene-related peptide type 1 receptor (calcrla) in Danio rerio (zebrafish) is the fish ortholog of the mammalian calcitonin receptor-like receptor (CLR). In mammals, CLR forms a complex with receptor activity-modifying protein 1 (RAMP1) to create a functional receptor for calcitonin gene-related peptide (CGRP), a 37 amino acid neuropeptide belonging to the calcitonin (CT) family of peptides . The CLR is a member of the family B (or secretin-like) G protein-coupled receptors (GPCRs) . In zebrafish, the calcrla gene encodes a receptor that, similar to its mammalian counterpart, likely requires association with RAMPs to form a functional CGRP receptor complex.

The calcrla receptor plays important roles in various physiological processes, including neurogenic inflammation, vasodilation, and nociception. Methodologically, identification and characterization of zebrafish calcrla typically involves molecular cloning from cDNA libraries, sequence analysis to confirm orthology, and functional studies using heterologous expression systems. The zebrafish model offers unique advantages for studying this receptor in the context of a whole organism with optical transparency during development.

How does the structure of CGRP affect its binding to the receptor?

CGRP has several key structural features that are critical for binding to its receptor and initiating signaling pathways. Based on structure-activity relationship studies, the peptide can be divided into four main regions, each with specific contributions to receptor interaction:

  • N-terminal disulphide-bonded ring (residues 1-7): This region is essential for receptor activation . The disulfide bond between residues Cys2 and Cys7 is absolutely critical, as its removal eliminates all agonist activity . Mutation studies show that modifications to Ala1 can significantly alter binding affinity, with some extensions causing up to 150-fold decreases in potency .

  • α-helix region (residues 8-18): This forms a secondary structure important for receptor interaction . The helix is stabilized in hydrophobic environments, suggesting it adopts this conformation when interacting with the receptor .

  • β-bend region (residues 19-26): Contains a β or γ turn around residues 18-21 . This region provides a structural transition between the α-helix and C-terminal portions.

  • C-terminal portion (residues 27-37): Characterized by bends between residues 28-30 and 33-34 . Specific residues in this region are critical for receptor binding, particularly Pro29, Gly33, and Phe37, with mutations at these positions dramatically reducing or eliminating binding .

CGRP follows a two-step binding mechanism where the C-terminus binds to the extracellular domain of the receptor, while the N-terminus (with the disulphide-bonded loop) interacts with the transmembrane domain to trigger activation .

What expression systems are suitable for producing recombinant zebrafish calcrla?

The successful expression of functional recombinant zebrafish calcrla requires careful consideration of expression systems that can support proper folding, post-translational modifications, and assembly with accessory proteins. Based on the complex nature of CGRP receptors, the following expression systems are recommended:

  • Mammalian cell lines: HEK293T or CHO cells provide the most suitable environment for proper folding and post-translational modifications of zebrafish calcrla. These systems allow co-expression with RAMP1, which is essential for forming functional CGRP receptors . Since the zebrafish's optimal temperature is around 28°C, culturing these cells at lower temperatures (28-30°C rather than 37°C) may improve protein folding and functionality.

  • Insect cell systems: Sf9 or High Five insect cells can produce higher yields of functional membrane proteins while maintaining proper folding. The baculovirus expression system allows for simultaneous expression of multiple proteins, facilitating the co-expression of calcrla with RAMP1 and receptor component protein.

  • Yeast systems: Pichia pastoris offers advantages for larger-scale production of membrane proteins, although optimization may be required for complex receptor assemblies.

  • Cell-free systems: For biochemical studies, cell-free expression systems supplemented with lipid nanodiscs or detergent micelles can produce functional receptor protein, though yields may be limited.

For optimal results, expression vectors should include codon-optimized sequences for the chosen host, appropriate signal peptides for membrane targeting, and purification tags that don't interfere with receptor assembly or function.

What methods can be used to verify calcrla expression patterns during zebrafish development?

Understanding the spatial and temporal expression patterns of calcrla during zebrafish development provides crucial insights into its physiological roles. The following methodological approaches are effective for characterizing expression patterns:

  • Quantitative RT-PCR: This technique allows precise measurement of calcrla mRNA levels at different developmental stages from embryonic to adult phases. Analysis should align with key developmental milestones such as birth (when embryo starts feeding), metamorphosis (transition from larval to juvenile stage), and puberty (onset of reproductive capability) .

  • In situ hybridization: Whole-mount in situ hybridization in embryos and larvae, combined with section in situ hybridization in juvenile and adult tissues, provides spatial information about calcrla expression domains. Based on mammalian CGRP receptor distribution, likely expression domains include the nervous system (central and peripheral), cardiovascular system, and gastrointestinal tract.

  • Transgenic reporter lines: Generation of transgenic zebrafish expressing fluorescent proteins (e.g., GFP) under the control of the calcrla promoter allows real-time visualization of expression patterns throughout development. This approach can be combined with time-lapse imaging for dynamic analysis.

  • Immunohistochemistry: Using specific antibodies against zebrafish calcrla (or epitope-tagged versions) enables protein-level detection in tissues. This can be particularly valuable for confirming translation and determining subcellular localization.

  • Single-cell RNA sequencing: This advanced technique provides high-resolution data on calcrla expression in specific cell types throughout development, revealing heterogeneity that might be missed by bulk tissue analysis.

These methods can be correlated with developmental energetics parameters from the Dynamic Energy Budget (DEB) theory, which provides a useful metric for developmental state in zebrafish .

What are the key considerations for designing primers to amplify zebrafish calcrla?

Designing effective primers for amplifying zebrafish calcrla requires attention to sequence specifics, potential splice variants, and experimental applications. The following methodological guidelines ensure successful amplification:

  • Sequence verification and analysis:

    • Retrieve the complete zebrafish calcrla sequence from genomic databases (NCBI, Ensembl, ZFIN)

    • Check for potential splice variants that might affect amplification

    • Analyze the genomic structure to identify exon-intron boundaries

    • Assess sequence similarity with related genes (e.g., calcitonin receptor) to avoid non-specific amplification

  • Primer design parameters:

    • Length: Optimal primers should be 18-25 nucleotides

    • GC content: Aim for 40-60% GC content for stable annealing

    • Melting temperature (Tm): Design primers with similar Tm values (within 2-3°C of each other), typically between 55-65°C

    • Avoid sequences prone to secondary structure formation or primer-dimer creation

    • Check for 3' end stability (avoid more than 3 G or C nucleotides in the last 5 positions)

  • Application-specific considerations:

    • For full-length cloning: Design primers at the 5' and 3' untranslated regions to capture the complete coding sequence

    • For expression constructs: Include appropriate restriction sites for cloning, ensuring they are not present in the gene sequence

    • For quantitative PCR: Design primers spanning exon-exon junctions to avoid genomic DNA amplification, with amplicon size of 80-150 bp

    • For mutation analysis: Include sufficient flanking sequence around the target site

  • Validation strategies:

    • Perform in silico PCR to predict potential amplification products

    • Test primers on both genomic DNA and cDNA to confirm specificity

    • Sequence amplification products to verify correct target amplification

    • Include positive controls (known amplifiable regions) and negative controls (no template)

These considerations help ensure specific and efficient amplification of zebrafish calcrla for various research applications.

How can functional assays be designed to assess the activity of recombinant zebrafish calcrla?

Developing robust functional assays for zebrafish calcrla requires consideration of its signaling pathways and receptor complex formation. The following methodological approaches provide comprehensive assessment of receptor functionality:

  • Receptor-ligand binding assays:

    • Radioligand binding using [125I]-labeled zebrafish CGRP or mammalian CGRP analogs

    • Competition binding assays to determine affinity constants (Ki) for various ligands

    • Saturation binding to calculate receptor density (Bmax) and dissociation constant (Kd)

    • Association and dissociation kinetics to measure binding rates (kon and koff)

    • FRET-based proximity assays using fluorescently labeled ligands and receptors

  • Signal transduction analysis:

    • cAMP accumulation assays: Since CGRP receptors primarily couple to Gs proteins, cAMP is a key second messenger . Options include:

      • ELISA-based detection systems

      • Real-time FRET sensors (EPAC-based) for live-cell monitoring

      • Luciferase reporter assays using CRE (cAMP response element) promoters

    • Calcium mobilization: CGRP can also trigger calcium responses in some contexts:

      • Fluorescent calcium indicators (Fura-2, Fluo-4)

      • Genetically encoded calcium indicators (GCaMP variants)

      • Plate reader-based high-throughput fluorescent measurements

    • ERK1/2 phosphorylation: Downstream MAPK activation can be measured by:

      • Western blotting with phospho-specific antibodies

      • Cell-based ELISA systems

      • Phospho-flow cytometry

  • Receptor trafficking studies:

    • Fluorescence microscopy to track internalization using tagged receptors

    • Flow cytometry to quantify surface expression levels

    • Bioluminescence resonance energy transfer (BRET) to measure protein-protein interactions

    • Antibody feeding assays to distinguish surface from internalized receptors

  • Comparative pharmacology:

    • Generate dose-response curves for zebrafish CGRP, mammalian CGRP, and related peptides

    • Test antagonists to develop pharmacological profiles

    • Analyze structure-activity relationships using CGRP analogs with specific modifications

    • Compare data across expression systems and species to identify conserved mechanisms

These assays should be performed under temperature conditions optimal for zebrafish proteins (around 28°C) , and results should be carefully normalized to account for differences in expression levels and cellular backgrounds.

What mutations in calcrla would likely affect CGRP binding and signaling?

Based on structure-activity relationships of CGRP and its receptor, specific mutations in zebrafish calcrla can be predicted to alter ligand binding and signaling properties. These predictions guide experimental design for structure-function studies:

  • N-terminal extracellular domain mutations:

    • Mutations in the N-terminal region would primarily affect peptide binding affinity without necessarily altering efficacy

    • Key residues likely include those that interact with the C-terminal portion of CGRP (residues 27-37)

    • Predicted critical sites include the conserved tryptophan residue found in family B GPCRs and acidic residues that might interact with the basic residues in CGRP

  • Extracellular loop mutations:

    • The extracellular loops (ECLs), particularly ECL2, are critical for ligand recognition

    • Mutations in ECL1 and ECL3 may alter the binding pocket conformation

    • Disulfide bonds between ECLs and transmembrane domains maintain receptor architecture; mutation of conserved cysteines would likely disrupt receptor function

  • Transmembrane domain mutations:

    • The transmembrane domains form the core of the receptor and contain residues that interact with the N-terminal region of CGRP

    • Mutations in TM3, TM5, and TM6 would likely affect receptor activation and signal transduction

    • Conserved residues in the "DRY" motif (TM3) and the "CWxP" motif (TM6) are critical for G protein coupling and receptor activation

  • Intracellular loop mutations:

    • Mutations in ICL3 would likely disrupt G protein coupling, particularly to Gs

    • Changes in ICL2 might alter the specificity of G protein coupling

    • Mutations in the C-terminal tail could affect receptor desensitization and internalization

  • Interface with RAMP1:

    • Mutations at the calcrla-RAMP1 interface would disrupt complex formation

    • These residues are primarily located in the N-terminal extracellular domain and TM1

Experimental approaches to test these predictions include site-directed mutagenesis, expression in heterologous systems, and comprehensive pharmacological characterization using the functional assays described earlier.

How can CRISPR-Cas9 be optimized for generating zebrafish calcrla mutants?

CRISPR-Cas9 gene editing provides powerful tools for studying calcrla function in vivo, but requires optimization for successful generation of zebrafish mutants. The following methodological approaches maximize efficiency and specificity:

  • gRNA design considerations:

    • Target early exons to ensure loss-of-function

    • Prioritize regions encoding functionally important domains (ligand binding, G protein coupling)

    • Select targets with minimal predicted off-target effects using algorithms specific for zebrafish genome

    • Design multiple gRNAs targeting different regions to increase chances of successful editing

    • Avoid regions with high GC content (>80%) or low GC content (<40%)

    • Ensure the PAM sequence (NGG for SpCas9) is available at the target site

  • CRISPR delivery methods:

    • Microinjection of Cas9 mRNA (100-300 ng/μL) and gRNA (25-50 ng/μL) into one-cell stage embryos

    • Alternative: ribonucleoprotein (RNP) complex injection with purified Cas9 protein (500-1000 ng/μL) and gRNA

    • Co-injection with fluorescent dextran to confirm successful injection

    • Careful control of injection volume (1-2 nL) for consistency

  • Mutation screening strategies:

    • High-resolution melt analysis (HRMA) for rapid screening of F0 and F1 generations

    • T7 endonuclease I (T7E1) or Surveyor assays to detect heteroduplex DNA

    • Direct sequencing of PCR products from fin clips

    • Fragment analysis for insertions/deletions that alter amplicon size

    • Next-generation sequencing for comprehensive mutation profiling

  • Generation of specific mutation types:

    • For knockout: Single gRNA targeting early exon, relying on NHEJ repair

    • For knock-in: Homology-directed repair with donor template containing desired mutation

    • For conditional models: Introduction of loxP sites for Cre-mediated recombination

    • For precise point mutations: Base editing or prime editing technologies

  • Breeding strategy for stable lines:

    • Outcross F0 mosaic founders to wild-type fish

    • Screen F1 offspring for germline transmission

    • Identify heterozygous carriers and intercross to generate homozygous mutants

    • Carefully phenotype F2 generation for developmental and physiological effects

  • Validation of mutant phenotypes:

    • Confirm mutation at DNA, RNA, and protein levels

    • Perform rescue experiments with wild-type calcrla mRNA

    • Compare phenotypes across multiple independent mutant lines

    • Conduct off-target analysis at predicted sites

These optimized approaches increase the likelihood of generating useful zebrafish calcrla mutants for functional studies.

What are the challenges in crystallizing the zebrafish calcrla protein for structural studies?

Obtaining crystal structures of zebrafish calcrla presents significant challenges due to its nature as a complex membrane protein. Understanding these challenges informs strategic approaches to structural biology:

  • Receptor complex stability issues:

    • The calcrla-RAMP1 complex may have weak interactions that dissociate during purification

    • The receptor exists in multiple conformational states (active, inactive, intermediate)

    • Membrane extraction often destabilizes the native conformation

    • Zebrafish proteins may have different thermal stability profiles compared to mammalian orthologs

  • Expression and purification challenges:

    • Achieving sufficient expression levels of properly folded protein

    • Maintaining the calcrla-RAMP1 complex throughout purification

    • Selecting optimal detergents that extract but don't denature the protein

    • Removing flexible regions that hinder crystallization without compromising function

  • Crystallization-specific obstacles:

    • Formation of well-ordered crystals that diffract to high resolution

    • Identifying stabilizing ligands or antibodies to reduce conformational heterogeneity

    • Optimizing crystallization conditions for a fish protein (temperature considerations)

    • Obtaining sufficient quantities of highly pure, homogeneous protein

  • Methodological solutions:

    • Protein engineering approaches:

      • Creating fusion proteins linking calcrla and RAMP1

      • Truncation of disordered N- and C-termini

      • Introduction of thermostabilizing mutations

      • Insertion of crystallization chaperones (T4 lysozyme, BRIL)

    • Advanced crystallization methods:

      • Lipidic cubic phase for membrane proteins

      • Antibody fragment (Fab) co-crystallization

      • Nanobody-assisted crystallography

      • In meso crystallization techniques

    • Alternative structural approaches:

      • Cryo-electron microscopy, which has revolutionized GPCR structural biology

      • Nuclear magnetic resonance for dynamic regions

      • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Species-specific considerations:

    • Optimal temperature range (25-28°C vs 37°C for mammalian proteins)

    • Use of zebrafish CGRP peptide for co-crystallization

    • Consideration of lipid environment matching fish membrane composition

These challenges highlight why structural studies of complex receptors like calcrla often require combining multiple approaches and significant optimization.

How can RNA-seq data inform studies of calcrla function in zebrafish models?

RNA sequencing provides powerful insights into calcrla function by revealing transcriptional networks and signaling pathways. The following methodological approaches maximize the utility of RNA-seq for calcrla research:

  • Experimental design considerations:

    • Temporal analysis across developmental stages correlated with calcrla expression

    • Tissue-specific transcriptomics focusing on known CGRP-responsive tissues

    • Comparison of wild-type, calcrla mutant, and rescued zebrafish

    • Differential expression analysis following CGRP treatment or receptor antagonism

    • Cell type-specific RNA-seq using FACS-sorted populations or single-cell approaches

  • Sample preparation optimization:

    • Precise dissection techniques for tissue-specific analysis

    • RNA extraction methods preserving transcript integrity

    • Poly(A) selection for mRNA analysis or rRNA depletion for total RNA including non-coding RNAs

    • Strand-specific library preparation for detecting antisense transcription

    • Unique molecular identifiers (UMIs) to control for PCR bias

  • Advanced RNA-seq applications:

    • Single-cell RNA-seq to identify cell populations expressing calcrla

    • Spatial transcriptomics to map expression domains with tissue context

    • Long-read sequencing to identify novel splice variants

    • Ribosome profiling to assess translational regulation

    • CLIP-seq to identify RNA-binding proteins regulating calcrla expression

  • Data analysis strategies:

    • Standard differential expression analysis to identify calcrla-dependent genes

    • Pathway enrichment to uncover signaling networks

    • Co-expression analysis to find genes with similar expression patterns

    • Transcription factor binding site analysis to identify regulators

    • Comparative analysis across species to find evolutionarily conserved mechanisms

  • Integration with other data types:

    • Correlation with phenotypic data from calcrla mutants

    • Integration with ChIP-seq to connect transcriptional changes with epigenetic regulation

    • Combination with proteomics data to assess post-transcriptional regulation

    • Validation of key findings with quantitative RT-PCR and in situ hybridization

These approaches provide a comprehensive view of calcrla's role in zebrafish biology, revealing both direct and indirect effects of CGRP signaling on gene expression networks.

Structure-activity relationships of CGRP residues relevant to receptor binding

The following table summarizes key findings from mutation studies of CGRP residues that inform our understanding of ligand-receptor interactions applicable to zebrafish calcrla research:

CGRP ResidueMutationEffect on Binding/ActivityExperimental SystemImplications for Zebrafish Research
Ala 1[Tyr 0]-CGRP3-fold decrease in affinitySK-N-MC cellsN-terminus critical for receptor activation
Ala 1Extension by biotin150-fold decrease in potencyL6 myocytesStrict steric requirements for binding pocket
Cys 2, Cys 7Removal of disulphideNo agonist activityRat atriaDisulfide bond essential for all species variants
Thr 4[Val 4]-CGRP8-fold decrease in affinityPorcine iris ciliary bodySide chain hydroxyl group likely forms hydrogen bond
Thr 6[Val 6]-CGRP5-fold decrease in affinity, no efficacyPorcine iris ciliary bodyCritical for receptor activation but not binding
Pro 29[Ala 29]-Tyr 0CGRP 27-37No bindingSK-N-MC cellsPro29 creates essential turn structure
Gly 33[Ala 33Ala 34Phe 35]-CGRP 27-3723-fold decrease in affinitySK-N-MC cellsGlycine flexibility important for C-terminal conformation
Phe 37[Ala 37]-CGRP 8-37>100-fold decrease in affinityRat pulmonary arteryAromatic ring critical for receptor binding pocket

These structure-activity relationships provide a foundation for designing zebrafish-specific CGRP analogs and predicting binding interfaces with calcrla.

Protocol for heterologous expression and functional characterization of zebrafish calcrla

The following protocol outlines the methodology for expressing and characterizing zebrafish calcrla in mammalian cells:

Materials:

  • Zebrafish calcrla cDNA (codon-optimized for mammalian expression)

  • Zebrafish RAMP1 cDNA

  • Expression vector with strong promoter (pcDNA3.1, pCMV-Tag, etc.)

  • HEK293T cells (maintained at 28°C for zebrafish protein expression)

  • Transfection reagent (Lipofectamine 3000 or similar)

  • Zebrafish CGRP peptide (custom synthesized)

  • cAMP assay kit (ELISA-based or FRET-based)

  • Calcium indicator dyes (Fluo-4/AM)

  • Radioligand ([125I]-CGRP)

Procedure:

  • Vector construction:

    • Clone zebrafish calcrla into expression vector with N-terminal signal peptide

    • Add C-terminal epitope tag (FLAG, HA) for detection

    • Clone zebrafish RAMP1 into separate vector with different tag

  • Cell culture and transfection:

    • Maintain HEK293T cells at 28°C in DMEM with 10% FBS

    • Seed cells at 5×10^5 cells/well in 6-well plates

    • Co-transfect calcrla and RAMP1 plasmids (1:1 ratio)

    • Include vector-only controls and mammalian CLR/RAMP1 for comparison

  • Expression verification:

    • Harvest cells 48 hours post-transfection

    • Perform Western blot analysis using tag-specific antibodies

    • Conduct immunofluorescence microscopy to confirm membrane localization

    • Use flow cytometry to quantify surface expression levels

  • Binding assays:

    • Prepare membrane fractions from transfected cells

    • Perform saturation binding with increasing concentrations of [125I]-CGRP

    • Conduct competition binding with unlabeled peptides

    • Calculate Kd, Bmax, and Ki values using nonlinear regression

  • Functional assays:

    • cAMP accumulation:

      • Treat cells with zebrafish CGRP (10^-12 to 10^-6 M)

      • Include forskolin (10 μM) as positive control

      • Measure cAMP using preferred detection method

      • Calculate EC50 values and maximum responses

    • Calcium mobilization:

      • Load cells with Fluo-4/AM (5 μM, 30 min)

      • Measure fluorescence before and after CGRP addition

      • Record real-time calcium traces

      • Calculate peak responses and response kinetics

  • Data analysis:

    • Generate dose-response curves using four-parameter logistic model

    • Compare pharmacological parameters between zebrafish and mammalian receptors

    • Perform statistical analysis (ANOVA with post-hoc tests)

    • Create graphs displaying binding affinities and signaling potencies

This protocol provides a comprehensive approach to characterizing zebrafish calcrla pharmacology and signaling properties.

Correlation of zebrafish developmental stages with predicted calcrla expression

Based on developmental energetics data and receptor expression patterns, the following table presents the relationship between zebrafish developmental milestones and predicted calcrla expression:

Developmental StageAge (days)Length (cm)Maturity LevelPredicted calcrla Expression Pattern
Embryo0-3<0.3EH < EHbNeural crest, primary sensory neurons, developing heart
Birth (start feeding)3-5~0.3EH = EHbPeripheral sensory neurons, pharyngeal arches, vascular precursors
Larval stage5-300.3-1.0EHb < EH < EHjExpanding nervous system, developing cardiovascular system, gut neurons
Metamorphosis30-40~1.0EH = EHjRestructuring tissues, increased in gill filaments, fine vasculature
Juvenile40-601.0-2.0EHj < EH < EHpMaturing nervous and cardiovascular systems, resembling adult pattern
Puberty60-902.0-2.5EH = EHpAdult distribution including reproductive tissues and mature vasculature
Adult>90>2.5EH > EHpFull expression in sensory neurons, vasculature, and other CGRP-responsive tissues

Note: EH represents maturity level, with subscripts b, j, and p indicating birth, metamorphosis, and puberty, respectively. There is a factor of 40 difference between maturity level at metamorphosis and birth (EHj and EHb) .

Optimal conditions for calcrla functional assays based on zebrafish physiology

The following table provides recommended experimental conditions for studying zebrafish calcrla function, considering the species' physiological parameters:

ParameterRecommended ConditionRationaleMethodological Considerations
Temperature28°C ± 0.5°COptimal for zebrafish physiology Maintain consistent temperature during all assays
pH7.2-7.4Mimics physiological conditionsBuffer with HEPES for stable pH during experiments
Cell culture mediumModified L-15 or DMEM/F12Supports both mammalian cells and zebrafish tissueSupplement with zebrafish serum for primary cell cultures
Expression systemHEK293T cellsHigh transfection efficiency for calcrla-RAMP1 co-expressionMaintain at lower temperature (28-30°C) for zebrafish protein folding
Incubation time48-72 hours post-transfectionAllows proper receptor complex formationMonitor expression levels over time to determine optimal window
cAMP assay conditionsStimulation: 15 minutes
Phosphodiesterase inhibitor: 0.5 mM IBMX
Captures optimal signaling windowInclude dose-response controls with forskolin
Calcium assay conditionsReal-time measurement
Fluo-4 loading: 30-45 minutes
Allows capture of rapid calcium transientsInclude positive controls (ATP, ionomycin)
Primary tissue preparationDissection in ice-cold zebrafish Ringer's solutionPreserves tissue viabilityProcess tissues within 1 hour of isolation
In vivo imagingLight sheet microscopy
GCaMP6f indicators
Allows whole-organism visualization of signalingMount embryos in 0.1-0.2% agarose to minimize movement

These conditions are optimized for maintaining zebrafish physiological relevance while ensuring robust experimental outcomes for calcrla research.

Comparative sequence analysis of CGRP receptors across species

The following table presents a comparative analysis of key domains and motifs in CGRP receptors from different species, highlighting conservation relevant to zebrafish calcrla research:

Domain/MotifHuman CLRMouse CLRPredicted Zebrafish calcrlaFunctional Significance
N-terminal ECD1-1221-121Shorter (typically 100-110 residues)Peptide C-terminus binding region
RAMP1 interaction surfaceW69, D70, F92, Y124ConservedPartially conserved (W and F typically retained)Critical for complex formation
WDG motifPresentPresentPresentEssential for ligand recognition
Disulfide bonding sites48-74, 65-105ConservedConservedMaintains ECD structure
ECL1ShorterShorterLikely longerContributes to binding pocket
ECL2Contains disulfideContains disulfideContains disulfideMajor contributor to ligand specificity
ECL3Moderately conservedModerately conservedLess conservedMinor role in binding
"DRY" motif in TM3PresentPresentPresentG protein coupling
"CWxP" motif in TM6PresentPresentPresentReceptor activation
C-terminal PDZ binding motifPresentPresentLikely absentScaffolding protein interactions

This comparative analysis helps predict key functional elements in zebrafish calcrla and identify regions that may have evolved species-specific properties relevant to experimental design.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.