Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-1 (slc25a24)

Shipped with Ice Packs
In Stock

Description

Key Properties of the Recombinant Protein:

ParameterDetails
Gene Nameslc25a24 (zgc:92470, scamc1)
Host OrganismE. coli or Yeast (expression systems)
Purity>85% (SDS-PAGE)
ApplicationsELISA, Western Blot (WB), Functional Assays
Tag InformationDetermined during production (e.g., His-tag for purification)

Biological Role in Mitochondrial Calcium Homeostasis

SCaMC-1 facilitates ATP-Mg²⁺ uptake into mitochondria in exchange for phosphate (Pi²⁻) . This activity buffers cytosolic calcium overload by modulating mitochondrial matrix calcium levels, thereby desensitizing the mitochondrial permeability transition (mPT) .

Mechanism of Action:

  1. Calcium-Triggered Transport: Elevated cytosolic Ca²⁺ activates SCaMC-1 to import ATP-Mg²⁺ and expel Pi²⁻, maintaining mitochondrial ATP production .

  2. mPT Regulation: ATP/ADP buffering by SCaMC-1 reduces matrix Ca²⁺ accumulation, preventing mPT-driven necrosis .

Functional Implications:

  • Cancer Cell Survival: Overexpression in transformed cells enhances calcium buffering, promoting resistance to oxidative stress .

  • Zebrafish Models: Used to study mitochondrial dysfunction and disease mechanisms .

Functional Validation

  • Transport Activity: SCaMC-1 mediates ATP-Mg²⁺/Pi²⁻ exchange in reconstituted proteoliposomes, confirmed via radiolabeled substrate assays .

  • Calcium Sensitivity: N-terminal EF-hands enable Ca²⁺-dependent regulation, though the domain is dispensable for mitochondrial targeting .

Comparative Analysis with Human SCaMC-1

FeatureDanio rerio SCaMC-1Human SCaMC-1 (SLC25A24)
Gene LocationChromosome 1 (zgc:92470)Chromosome 1 (SLC25A24)
ExpressionBroad (ubiquitous in zebrafish)Elevated in cancer cells
FunctionATP-Mg²⁺/Pi²⁻ transportATP-Mg²⁺/Pi²⁻ transport

Research Challenges and Future Directions

  • Isoform Diversity: SCaMC-1 lacks alternative splicing variants observed in SCaMC-2 (human) , simplifying functional studies.

  • Therapeutic Targeting: Inhibiting SCaMC-1 could enhance mPT sensitivity in cancer cells, though off-target effects on mitochondrial ATP production remain a concern .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All protein shipments are made with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us during your order placement. We will prioritize developing the specified tag if possible.
Synonyms
slc25a24; scamc1; si:ch211-63o20.9; zgc:92470; Calcium-binding mitochondrial carrier protein SCaMC-1; Small calcium-binding mitochondrial carrier protein 1; Solute carrier family 25 member 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a24
Target Protein Sequence
MHQLIRKFVFTESHCLEEEDNTKSFAELFEKLDVNKDGKVDVSELKTGLAAMGFSMGKGE AQKIVTSGDTDKDEGLDFEEFSKYLKEHEKKLRLTFKSLDKNEDGRVDAKEIQQSLKDLG INLSDKDAEKILHSIDVDGTMTLDWNEWREHFLFNPAEDLQQIIRYWKKSTVLDIGDSLT IPDEFTEEEKTTGMWWKQLAAGGVAGAVSRTGTAPLDRMKVFMQVHSSKTNKISLVNGFK QMIKEGGVASLWRGNGVNVIKIAPETAIKFMAYEQYKKLLSKDGGKVQSHERFMAGSLAG ATAQTAIYPMEVMKTRLTLRKTGQYSGMFDCAKKILRKEGVKAFYKGYVPNILGIIPYAG IDLAVYETLKNTWLSHYAKDTANPGVLVLLGCGTISSTCGQLASYPLALIRTRMQAMASM EGSEQVSMSKLVKKIMQKEGFFGLYRGILPNFMKVIPAVSISYVVYEYMRSGLGISK
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier. Facilitates the reversible, electroneutral exchange of Mg-ATP or Mg-ADP against phosphate ions, thereby catalyzing the net uptake or efflux of adenine nucleotides across the mitochondrial inner membrane. Nucleotide transport is inactive at low cytosolic calcium levels but is activated by an increase in cytosolic calcium levels. This protein may play a role in protecting cells from oxidative stress-induced cell death, possibly by promoting the formation of calcium-phosphate precipitates in the mitochondrial matrix, thereby buffering calcium levels within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of SCaMC-1/SLC25A24 in zebrafish mitochondria?

SCaMC-1/SLC25A24 functions as a mitochondrial carrier that mediates ATP-Mg²⁺/Pi²⁻ and/or HADP²⁻/Pi²⁻ uptake into the mitochondria following increases in cytosolic calcium concentrations [Ca²⁺]. This transport activity is crucial for the regulation of calcium buffering within the mitochondrial matrix. The carrier consists of a C-terminal domain with six transmembrane helices (characteristic of mitochondrial carrier proteins) and an N-terminal domain containing Ca²⁺-binding EF hands that confer calcium sensitivity to the transporter. Through this mechanism, SCaMC-1 contributes to the desensitization of the mitochondrial permeability transition (mPT), which is a critical pathway in stress-induced cell death .

How is SCaMC-1 related to evolutionary conservation in zebrafish compared to mammalian systems?

The ATP-Mg/Pi carrier family (SCaMCs) shows strong evolutionary conservation across vertebrates, with the zebrafish homolog SLC25A25 being validated as functionally significant in TRPP2-dependent signaling pathways. In mammals, this carrier family has evolved greater complexity, comprising four paralogs (SCaMC-1, -2, -3, and -3L) plus several splicing variants. Additionally, mammals express a specific paralog called SCaMC-1Like (SCaMC-1L) that shows unique tissue distribution patterns in comparison to its closest relative SCaMC-1 .

Research demonstrates that while zebrafish express a more streamlined version of this carrier system, the fundamental mechanisms of action remain conserved. The zebrafish model system has been particularly valuable for understanding the role of Slc25a25b in left-right patterning during embryonic development, where it functions downstream of Trpp2 (pkd2) in an evolutionarily conserved metabolic signaling pathway .

What are the established phenotypes associated with SCaMC-1/SLC25A25 loss in zebrafish models?

Loss of Slc25a25b in zebrafish produces distinctive developmental phenotypes, most notably the randomization of left-right asymmetry during embryonic development. This phenotype closely resembles the effects observed following loss of Trpp2 (pkd2), suggesting a functional relationship between these proteins in signaling pathways governing embryonic patterning .

Importantly, detailed analyses reveal that the number of cilia, ciliary length, and cilia-dependent directional flow generation in Kupffer's vesicle (the zebrafish left-right organizer) remain unaffected by loss of Slc25a25b. This indicates that Slc25a25b functions downstream of ciliary mechanosensation rather than in cilia formation or function. These observations establish Slc25a25b as an essential component of the cilia-dependent signaling pathway that connects ciliary signaling to mitochondrial metabolism in vertebrate development .

What are the most effective approaches for generating SCaMC-1 knockdown models in zebrafish?

Methodological Approach for Zebrafish SCaMC-1 Modification:

When designing SCaMC-1 knockdown or knockout studies in zebrafish, researchers should consider multiple complementary approaches:

  • Morpholino Oligonucleotides (MOs): For rapid, transient knockdown experiments, antisense MOs targeting slc25a25b can be injected into 1-2 cell stage embryos. While effective for initial screening, researchers should be aware of potential off-target effects.

  • CRISPR-Cas9 Genome Editing: For permanent genetic modifications, CRISPR-Cas9 can be utilized to target specific regions of the slc25a25b gene. Based on successful approaches documented in related studies, researchers should design guide RNAs targeting critical exons encoding functional domains.

  • Validation Strategy: Given the evolutionary conservation between zebrafish and mammalian homologs, researchers should confirm knockdown efficacy through:

    • RT-qPCR to verify transcript reduction

    • Western blotting with validated antibodies to confirm protein depletion

    • Phenotypic analysis focusing on left-right patterning defects as a readout of successful gene disruption

What experimental protocols are recommended for studying calcium-dependent mitochondrial functions of SCaMC-1 in isolated zebrafish mitochondria?

Recommended Protocol for Studying SCaMC-1 Calcium-Dependent Functions:

  • Mitochondrial Isolation from Zebrafish Tissues:

    • Homogenize tissue in isolation buffer (250 mM sucrose, 1 mM EGTA, 10 mM HEPES, pH 7.4)

    • Perform differential centrifugation: 1,000g (10 min), then supernatant at 10,000g (10 min)

    • Wash mitochondrial pellet and resuspend in experimental buffer

  • Calcium Retention Capacity (CRC) Assay:

    • Load mitochondria (0.5 mg/ml) in assay buffer (125 mM KCl, 10 mM HEPES, 2 mM KH₂PO₄, 1 mM MgCl₂, 5 mM succinate)

    • Monitor calcium fluctuations using 1 μM Calcium Green-5N

    • Add sequential calcium pulses (10-20 μM CaCl₂) until mitochondrial permeability transition occurs

    • Compare CRC between wild-type and SCaMC-1 deficient samples

  • ATP/ADP Transport Measurements:

    • Incubate mitochondria with radiolabeled [³H]ATP or [³H]ADP

    • Apply varying calcium concentrations (0-100 μM)

    • Terminate transport at defined time points with inhibitor stop solution

    • Quantify nucleotide uptake via filtration and scintillation counting

This methodology allows researchers to assess how SCaMC-1 mediates the relationship between cytosolic calcium signaling and mitochondrial adenine nucleotide transport, which is critical for understanding its role in cellular bioenergetics and stress responses .

What is the optimal recombinant expression system for producing functional Danio rerio SCaMC-1 protein for biochemical studies?

Optimization of Recombinant Danio rerio SCaMC-1 Expression:

Based on structural similarities with mammalian homologs and specific characteristics of membrane proteins, the following expression systems are recommended:

  • Bacterial Expression (E. coli):

    • System: BL21(DE3) with pET vector incorporating N-terminal His₆-tag

    • Induction: 0.2-0.5 mM IPTG at 18°C overnight

    • Solubilization: 1% DDM or LDAO detergent

    • Limitation: May yield inclusion bodies requiring refolding protocols

  • Insect Cell Expression (Preferred):

    • System: Sf9 or High Five cells with baculovirus vector

    • Constructs: Full-length protein and N-terminal domain (residues 1-184)

    • Purification: Two-step approach using affinity chromatography followed by size exclusion

    • Advantage: Superior folding of complex membrane proteins with multiple domains

  • Mammalian Expression:

    • System: HEK293 or COS-7 cells as used for SCaMC-1L studies

    • Vectors: pCMV5 or similar mammalian expression vectors

    • Strategy: Create chimeric constructs exchanging domains between zebrafish and human SCaMC-1 to assess functional regions

The choice of expression system should be guided by the specific experimental requirements, with insect cell expression generally providing the best balance between yield and proper folding for functional studies of this calcium-binding mitochondrial carrier protein .

How can SCaMC-1 be utilized as a target for studying mitochondrial involvement in zebrafish models of cancer?

Research Strategy for SCaMC-1 in Zebrafish Cancer Models:

Zebrafish provide an excellent platform for studying SCaMC-1's role in cancer due to their optical transparency, genetic tractability, and conservation of cancer-related pathways. A comprehensive experimental approach should include:

  • Transgenic Model Development:

    • Generate zebrafish lines with fluorescently tagged SCaMC-1 (e.g., SCaMC-1-GFP)

    • Create inducible SCaMC-1 overexpression models using tissue-specific promoters relevant to cancer types where SCaMC-1 upregulation has been documented

    • Establish CRISPR-Cas9 knockdown/knockout lines for loss-of-function studies

  • Cancer Induction and Analysis:

    • Utilize established zebrafish cancer models (e.g., MYCN-driven neuroblastoma, hepatocellular carcinoma)

    • Implement genetic crosses between cancer models and SCaMC-1 modified lines

    • Perform xenografts of human cancer cells with modified SCaMC-1 expression into zebrafish embryos

  • Mechanistic Studies:

    • Conduct live imaging of mitochondrial Ca²⁺ dynamics using genetically encoded calcium indicators

    • Measure mitochondrial permeability transition susceptibility in isolated tumor cells

    • Analyze SCaMC-1-dependent resistance to oxidative stress and Ca²⁺ overload

This approach leverages findings that SCaMC-1 overexpression is a characteristic feature of transformed and cancer cells. By manipulating SCaMC-1 levels and activity, researchers can investigate how this carrier contributes to cancer cell survival through enhanced mitochondrial Ca²⁺ buffering and desensitization to permeability transition-mediated cell death .

What experimental approaches can be used to study the relationship between TRPP2 and SCaMC-1 in zebrafish left-right patterning?

Experimental Design for TRPP2-SCaMC-1 Signaling Studies:

To investigate the functional relationship between TRPP2 and SCaMC-1 in zebrafish left-right development, implement the following multifaceted approach:

  • Genetic Interaction Analysis:

    • Create partial knockdowns of both pkd2 (TRPP2) and slc25a25b (SCaMC-1)

    • Generate double heterozygous mutants and analyze synergistic effects

    • Perform rescue experiments expressing SCaMC-1 in pkd2 mutants to test for pathway hierarchy

  • Calcium Signaling Visualization:

    • Utilize transgenic lines expressing GCaMP calcium indicators in Kupffer's vesicle

    • Conduct high-speed confocal imaging to capture calcium transients

    • Compare calcium dynamics in wild-type, pkd2-deficient, and slc25a25b-deficient embryos

  • Mitochondrial Metabolism Assessment:

    • Measure ATP levels in left-right organizer cells under various genetic conditions

    • Analyze mitochondrial membrane potential using potential-sensitive dyes

    • Investigate metabolic profiles through targeted metabolomics

  • Molecular Pathway Analysis:

    • Perform RNA-seq on isolated Kupffer's vesicle cells from wild-type and mutant embryos

    • Identify downstream effectors through phosphoproteomics

    • Validate key components using in situ hybridization and immunohistochemistry

This comprehensive approach will help delineate the evolutionary conserved signaling pathway through which TRPP2-dependent calcium signaling regulates SCaMC-1/slc25a25b activity to influence mitochondrial metabolism and ultimately left-right organ patterning .

What are the advantages and limitations of using Danio rerio SCaMC-1 models compared to mammalian models for studying mitochondrial calcium regulation?

Comparative Analysis of Zebrafish vs. Mammalian SCaMC-1 Models:

AspectZebrafish AdvantagesZebrafish LimitationsMammalian Model Considerations
Genetic ComplexitySimpler paralog structure facilitates functional studies without redundancyMay miss functionally important interactions between multiple paralogsMultiple paralogs (SCaMC-1,-2,-3,-3L) and splice variants can obscure individual contributions
Developmental StudiesTransparent embryos enable real-time imaging of organogenesis and left-right patterningCertain organ systems differ from mammalsMore directly relevant to human development but less accessible for imaging
High-throughput CapacityHundreds of embryos can be analyzed simultaneously for rapid screeningLimited tissue amount restricts biochemical analysesSmaller sample sizes but greater tissue availability for detailed biochemical studies
Drug ScreeningFacilitated by water-soluble compound delivery and rapid developmentAbsorption through skin may affect dosing precisionMore reliable pharmacokinetics but lower throughput
Cancer ModelingFast-growing tumors with conserved pathwaysSome cancer-specific pathways may differBetter tumor microenvironment modeling but slower development
Mitochondrial FunctionConserved core machinery allows fundamental studiesPotential differences in stress responses and metabolic adaptationsMore translatable to human disease but more complex genetic background

Researchers should consider these trade-offs when selecting model systems, recognizing that zebrafish offer particular advantages for studying developmental roles of SCaMC-1 and for high-throughput screening applications, while mammalian models may better recapitulate the complexity of SCaMC paralog interactions relevant to human disease states .

How can researchers address challenges in interpreting conflicting data on SCaMC-1 function between in vitro and in vivo zebrafish studies?

Resolving Discrepancies Between In Vitro and In Vivo Findings:

When confronted with conflicting data between isolated mitochondria/cell culture and whole zebrafish studies of SCaMC-1 function, implement this systematic resolution strategy:

  • Contextual Analysis:

    • Document specific experimental conditions (temperature, pH, ion concentrations) that differ between systems

    • Consider developmental stage-specific effects in zebrafish versus static cell culture conditions

    • Evaluate whether supporting cellular machinery present in vivo might be absent in vitro

  • Technical Validation:

    • Perform parallel experiments using identical reagents and protein sources

    • Develop quantitative assays applicable across both systems (e.g., standardized calcium retention capacity measurements)

    • Implement complementary techniques to measure the same parameter

  • Bridging Experiments:

    • Develop ex vivo systems using freshly isolated tissues or primary cells from zebrafish

    • Utilize tissue slices that maintain native architecture while permitting controlled manipulations

    • Create 3D organoid cultures from zebrafish cells that better recapitulate in vivo complexity

  • Mathematical Modeling:

    • Develop computational models incorporating known parameters from both systems

    • Identify potential hidden variables that might explain discrepancies

    • Test model predictions with targeted experiments

  • Genetic Approaches:

    • Create equivalent genetic modifications across systems (e.g., same point mutations)

    • Use domain-swapping experiments between zebrafish and mammalian SCaMC-1

    • Implement tissue-specific or inducible manipulations to pinpoint spatiotemporal factors

This systematic approach acknowledges that differences between in vitro and in vivo findings may reflect genuine biological complexity rather than experimental artifacts, potentially revealing important regulatory mechanisms that modulate SCaMC-1 function in different contexts .

What statistical approaches are most appropriate for analyzing the effects of SCaMC-1 manipulation on mitochondrial calcium buffering in zebrafish tissues?

Statistical Framework for SCaMC-1 Calcium Buffering Analysis:

When analyzing mitochondrial calcium buffering experiments involving SCaMC-1 manipulation in zebrafish tissues, researchers should implement the following statistical methodology:

How can researchers differentiate between direct effects of SCaMC-1 manipulation and secondary compensatory responses in zebrafish mitochondria?

Methodological Framework for Distinguishing Primary and Secondary Effects:

To differentiate direct SCaMC-1 effects from compensatory responses in zebrafish mitochondria, implement this sequential experimental approach:

  • Temporal Analysis:

    • Employ inducible genetic systems (heat shock or chemical induction) to achieve acute SCaMC-1 manipulation

    • Perform time-course experiments sampling at multiple intervals post-manipulation (minutes, hours, days)

    • Analyze immediate bioenergetic changes (ATP/ADP ratio, oxygen consumption) versus long-term adaptations

  • Selective Inhibition Strategies:

    • Utilize specific SCaMC-1 inhibitors in acute applications to bypass compensatory responses

    • Implement combinatorial approaches blocking known compensatory pathways

    • Design competitive substrate experiments to isolate carrier-specific functions

  • Domain-Specific Manipulation:

    • Create point mutations in functional domains (Ca²⁺-binding sites, carrier domain)

    • Develop chimeric proteins with selective domain swapping between SCaMC-1 and related carriers

    • Express truncated versions containing specific functional domains

  • Comprehensive 'Omics' Assessment:

    • Compare transcriptomic profiles at different time points following SCaMC-1 manipulation

    • Analyze the mitochondrial proteome to identify upregulated compensatory proteins

    • Perform metabolomic analysis to detect shifts in metabolic pathways

  • Integrative Physiological Measurements:

    • Assess whole-organism responses to stressors in SCaMC-1 modified zebrafish

    • Measure tissue-specific calcium dynamics under baseline and stressed conditions

    • Evaluate mitochondrial morphology and network dynamics temporally

This structured approach enables researchers to distinguish between primary molecular events directly attributable to SCaMC-1 activity and secondary adaptive responses that may confound interpretation of experimental results. By implementing temporal control and domain-specific manipulations, investigators can more accurately characterize the fundamental functions of this important mitochondrial carrier .

What emerging technologies could enhance our understanding of SCaMC-1 dynamics in zebrafish mitochondria?

Emerging Technologies for SCaMC-1 Research:

Several cutting-edge methodologies are poised to revolutionize our understanding of SCaMC-1 dynamics in zebrafish mitochondria:

  • Advanced Imaging Approaches:

    • Lattice light-sheet microscopy for long-term, low-phototoxicity imaging of mitochondrial dynamics in living zebrafish

    • Super-resolution techniques (STED, PALM, STORM) to visualize SCaMC-1 distribution within mitochondrial membranes at nanoscale resolution

    • Correlative light and electron microscopy (CLEM) to connect functional data with ultrastructural context

  • Genetically Encoded Biosensors:

    • Develop dual-parameter sensors simultaneously monitoring calcium and ATP/ADP in mitochondria

    • Create FRET-based sensors reporting SCaMC-1 conformational changes upon calcium binding

    • Implement mitochondria-targeted pH and membrane potential indicators for comprehensive bioenergetic analysis

  • Genome Engineering Advancements:

    • Prime editing for precise nucleotide-level modifications of SCaMC-1 without double-strand breaks

    • Optogenetic control of SCaMC-1 expression or activity enabling spatiotemporal regulation

    • Base editing technologies for introducing specific amino acid substitutions

  • Single-Cell Technologies:

    • Single-cell proteomics to characterize cell-type specific SCaMC-1 interactomes

    • Spatial transcriptomics correlating SCaMC-1 expression with tissue microenvironments

    • Microfluidic platforms isolating individual mitochondria for functional analysis

These technologies will enable researchers to address previously intractable questions about SCaMC-1 function, including how its activity is dynamically regulated in response to changing cellular conditions, how it interacts with other mitochondrial proteins in native environments, and how its function varies across different tissues and developmental stages in zebrafish .

How might understanding SCaMC-1 function in zebrafish contribute to developing therapeutic strategies for mitochondrial diseases?

Translational Applications of SCaMC-1 Research for Mitochondrial Disease Therapy:

Zebrafish SCaMC-1 research offers several promising avenues for therapeutic development against mitochondrial diseases:

  • Target Validation and Drug Discovery:

    • Establish high-throughput zebrafish-based screens for compounds modulating SCaMC-1 activity

    • Validate small molecules enhancing mitochondrial calcium buffering capacity via SCaMC-1 dependent mechanisms

    • Identify natural compounds that stabilize mitochondrial function through SCaMC-1 pathway modulation

  • Disease Modeling and Intervention Testing:

    • Generate zebrafish models mimicking human mitochondrial diseases with calcium homeostasis disruption

    • Test SCaMC-1 overexpression as a protective strategy against mitochondrial permeability transition

    • Develop compensatory approaches targeting parallel pathways when SCaMC-1 function is compromised

  • Gene Therapy Approaches:

    • Design and validate adenoassociated virus (AAV) vectors for tissue-specific SCaMC-1 delivery

    • Test mRNA therapeutics for transient SCaMC-1 supplementation during acute mitochondrial stress

    • Implement CRISPR-based strategies to correct pathogenic mutations affecting SCaMC-1 function

  • Biomarker Development:

    • Identify metabolic signatures of altered SCaMC-1 function translatable to human diagnostics

    • Correlate SCaMC-1 activity levels with disease progression and treatment responsiveness

    • Develop non-invasive imaging methods for assessing mitochondrial calcium regulatory capacity

The translational potential of zebrafish SCaMC-1 research is particularly significant for conditions involving pathological mitochondrial calcium overload, such as ischemia-reperfusion injury, neurodegenerative diseases, and certain cancer types where modulating mitochondrial permeability transition represents a therapeutic opportunity .

What are the potential implications of SCaMC-1's evolutionary conservation for understanding fundamental mechanisms of calcium-regulated mitochondrial metabolism?

Evolutionary Perspectives on SCaMC-1 and Mitochondrial Calcium Regulation:

The evolutionary conservation of SCaMC-1/SLC25A25 across vertebrates provides a powerful lens for understanding fundamental aspects of mitochondrial calcium regulation:

  • Ancestral Functions vs. Specialized Adaptations:

    • Compare SCaMC-1 structure and function across diverse species from fish to mammals

    • Analyze paralogs (SCaMC-1,-2,-3,-3L) to identify core conserved domains versus species-specific variations

    • Trace the evolutionary history of calcium-regulated adenine nucleotide transport in relation to cellular complexity

  • Convergent Evolution in Calcium Regulatory Systems:

    • Investigate how different organisms have evolved solutions for calcium-regulated mitochondrial metabolism

    • Examine potential convergent mechanisms between SCaMC proteins and other calcium-sensitive transporters

    • Compare calcium homeostasis mechanisms across evolutionary distances to identify universal principles

  • Adaptation to Environmental Challenges:

    • Study SCaMC-1 adaptations in fish species living in extreme environments (temperature, oxygen levels)

    • Analyze expression patterns and functional properties in cold-adapted versus warm-adapted vertebrates

    • Investigate potential coevolution with other components of calcium handling machinery

  • Developmental Conservation and Divergence:

    • Compare embryonic roles of SCaMC-1/SLC25A25 across vertebrates in left-right patterning

    • Analyze temporal expression patterns during development in multiple model organisms

    • Investigate the relationship between SCaMC function and the evolution of complex organ systems

This evolutionary perspective reveals that while SCaMC-1 maintains conserved core functions in adenine nucleotide transport and calcium buffering across vertebrates, species-specific adaptations reflect the diverse metabolic demands encountered throughout evolution. The conserved relationship between SCaMC-1/SLC25A25 and TRPP2 signaling across species highlights the fundamental importance of this pathway in connecting ciliary calcium signaling to mitochondrial metabolism, a linkage with profound implications for understanding both normal development and disease pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.