Recombinant Danio rerio Calcium-binding mitochondrial carrier protein SCaMC-2-A (slc25a25a)

Shipped with Ice Packs
In Stock

Description

Biochemical and Functional Characteristics

SCaMC-2-A (slc25a25a) is a 469-amino acid protein with a molecular weight of approximately 52 kDa . Key features include:

PropertyDetails
Gene Nameslc25a25a (synonyms: scamc2a, zgc:77454)
Protein FunctionCalcium-regulated ATP-Mg/P<sub>i</sub> transporter
DomainsMitochondrial carrier domain, four EF-hand calcium-binding motifs
Key InteractionsCooperates with TRPP2 ion channels in calcium signaling pathways
Tissue LocalizationPredominantly expressed in mitochondria-rich tissues (e.g., liver, gonads)

The protein’s calcium-binding ability enables it to act as a metabolic sensor, modulating mitochondrial ATP levels in response to cytosolic Ca<sup>2+</sup> fluctuations .

Recombinant Protein Production

Commercially available recombinant SCaMC-2-A is produced using E. coli or mammalian cell expression systems. Key product specifications include:

ParameterDetails
Product CodeCSB-CF747380DIL (Cusabio) ; SLC25A25A-12454Z (Creative BioMart)
TagN-terminal 10×His tag for purification
Purity>90% (SDS-PAGE verified)
Storage-20°C in Tris-based buffer with 50% glycerol
Sequence CoverageFull-length (1-469 amino acids)

The recombinant protein retains native biochemical activity, including Ca<sup>2+</sup>-dependent conformational changes and Mg-ATP transport .

Role in Mitochondrial Metabolism

SCaMC-2-A regulates mitochondrial adenine nucleotide pools by importing ATP-Mg into the matrix in exchange for phosphate (P<sub>i</sub>). Key findings from functional studies include:

  • Ca<sup>2+</sup> Activation: Transport activity increases by 3.5-fold in the presence of Ca<sup>2+</sup> (EC<sub>50</sub> = 0.8 µM) .

  • Metabolic Impact: Knockout models show reduced cellular ATP (-40%) and altered branched-chain amino acid metabolism .

  • Developmental Defects: Zebrafish slc25a25a knockdown disrupts left–right patterning by impairing Nodal signaling, mimicking TRPP2 deficiency .

Evolutionary Conservation

SCaMC-2-A is functionally conserved across species:

  • Human Ortholog (SLC25A25): Rescues male infertility in Drosophila SCaMC mutants .

  • Structural Homology: Shares 68% sequence identity with human SLC25A25 in the Ca<sup>2+</sup>-binding EF-hand domains .

Interaction Network

SCaMC-2-A operates in a conserved pathway with TRPP2 (polycystin-2) ion channels:

ComponentRole in Pathway
TRPP2Generates Ca<sup>2+</sup> signals at ciliary/ER-mitochondria junctions
SCaMC-2-ATranslates Ca<sup>2+</sup> signals into metabolic adjustments
Downstream TargetsNodal cascade (southpaw, lefty2), BCAA metabolism enzymes

This pathway ensures mitochondrial metabolic adaptations during developmental processes like embryogenesis and spermatogenesis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
slc25a25a; scamc2a; slc25a25; zgc:77454; Calcium-binding mitochondrial carrier protein SCaMC-2-A; Small calcium-binding mitochondrial carrier protein 2-A; Solute carrier family 25 member 25-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-469
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
slc25a25a
Target Protein Sequence
MLCLCLYVPVHNSDQIEVEYFESNGLPSELKSLKSLSVLLPSQEFSTYRRWRKKSLKTEE KEHDGQLDFEEFVHYLQDHEKDLKLVFKSMDRKIAGQVNANDIVNSLRDLGVHISLKQAE KVLKSMDKNGTMTIDWNEWKKYPTLQPAENIPEIILYWKHSTIFDVGESLMVPDEFTVEE HLTGMWWRHLVSGGGAGAVSRTCTAPLDRLKVLMQVHGCQGKSMCLMSGLTQMIKEGGVR SLWRGNGINVIKIAPETALKFMAYEQIKRVMGSSQETLGISERFVAGSLAGVIAQSTIYP MEVLKTRLALRKTGQYKGISDCAKHILKTEGMSAFYKGYVPNMLGIIPYAGIDLAVYETL KNTWLQRYGTENADPGVFVLLACGTVSSTCGQLASYPLALIRTRMQAQASVEGSSQVSMT GLFKQIMKTEGPTGLYRGLTPNFLKVIPAVSISYVVYEHIKSTLGVRSR
Uniprot No.

Target Background

Function
Calcium-dependent mitochondrial solute carrier.
Database Links

KEGG: dre:406541

STRING: 7955.ENSDARP00000008863

UniGene: Dr.7614

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Calcium-binding mitochondrial carrier protein SCaMC-2-A (slc25a25a) in Danio rerio?

Calcium-binding mitochondrial carrier protein SCaMC-2-A (slc25a25a) in Danio rerio functions as a calcium-dependent mitochondrial solute carrier that participates in shuttling metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Similar to its human ortholog SLC25A25, the zebrafish slc25a25a likely acts as an ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, thereby catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria . The presence of calcium-binding EF-hand motifs in the N-terminal region of the protein allows for regulation by cytosolic calcium, providing a mechanism to transduce calcium signals in mitochondria without requiring calcium entry into the organelle . This transporter plays a crucial role in linking ciliary signaling with mitochondrial metabolism, particularly in developmental processes like left-right patterning during embryogenesis.

The protein belongs to the SCaMC (short calcium-binding mitochondrial carriers) subfamily, which is characterized by a mitochondrial carrier domain at the C-terminus and an N-terminal extension containing multiple EF-hand calcium-binding motifs with high similarity to calmodulin . In zebrafish, slc25a25a works in conjunction with the TRPP2 ion channel in an evolutionarily conserved signaling pathway, where calcium signals from TRPP2 can regulate the activity of slc25a25a, affecting mitochondrial function and cellular metabolism . This interplay is particularly important during embryonic development, where proper calcium signaling and metabolic regulation are essential for establishing asymmetric gene expression patterns.

How does the structure of slc25a25a relate to its calcium-sensing function?

The structure of slc25a25a reflects its dual role as both a calcium sensor and a mitochondrial carrier protein. Like other members of the SCaMC subfamily, slc25a25a contains approximately 500 amino acids with a characteristic mitochondrial carrier domain at the C-terminus, responsible for metabolite transport, and an N-terminal extension harboring four EF-hand calcium-binding motifs that share high similarity with calmodulin . These EF-hand motifs face the cytosolic side of the mitochondrial membrane, allowing the protein to directly sense changes in cytosolic calcium concentration without requiring calcium to enter the mitochondria. This structural arrangement enables slc25a25a to function as a transducer of calcium signals, linking cytosolic calcium fluctuations to changes in mitochondrial metabolism.

The calcium-binding domain of slc25a25a undergoes conformational changes upon calcium binding, which alters the transport activity of the carrier domain. When calcium binds to the EF-hand motifs, it induces a structural shift that modifies the conformation of the carrier domain, thereby regulating its transport activity . This mechanism provides a direct link between cytosolic calcium signaling and mitochondrial metabolite transport. Thermostability assays of the human ortholog SLC25A25 have demonstrated a biphasic unfolding profile, indicating that the protein exists in two distinct conformational states depending on calcium binding status - a calcium-bound state with higher stability (apparent Tm = 49.5°C) and a calcium-free state with lower stability . This structural transition is crucial for the protein's function in responding to calcium signals and translating them into changes in mitochondrial metabolism.

What are the optimal methods for expressing and purifying recombinant Danio rerio slc25a25a protein?

The optimal expression and purification of recombinant Danio rerio slc25a25a requires careful consideration of expression systems, fusion tags, and purification strategies to obtain functional protein with intact calcium-binding properties. Based on approaches used for similar calcium-binding mitochondrial carriers, a bacterial expression system using E. coli BL21(DE3) can be employed with specific modifications to accommodate the unique properties of membrane proteins with calcium-binding domains . The full-length slc25a25a cDNA should be cloned into an expression vector incorporating an N-terminal histidine tag followed by a TEV protease cleavage site to facilitate subsequent tag removal. Expression should be induced at lower temperatures (16-18°C) to enhance proper protein folding, with the addition of 0.1-0.5 mM IPTG for 12-16 hours.

For membrane protein purification, a multi-step approach is recommended, beginning with cell lysis in a buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5% glycerol, 1 mM PMSF, and protease inhibitor cocktail. Initial purification via immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be performed with a gradient of imidazole (10-300 mM). Following TEV protease cleavage to remove the histidine tag, size exclusion chromatography using a Superdex 200 column equilibrated with a buffer containing 20 mM HEPES (pH 7.4), 150 mM NaCl, and 5% glycerol provides further purification. For functional studies, the protein should be reconstituted into liposomes composed of a mixture of phosphatidylcholine and phosphatidylethanolamine (7:3 ratio) using a detergent removal method with Bio-Beads. This reconstitution preserves the native conformation and enables proper assessment of transport activity and calcium regulation.

How can researchers effectively measure calcium-dependent transport activity of recombinant slc25a25a?

Measuring the calcium-dependent transport activity of recombinant slc25a25a requires specialized assays that can detect the exchange of adenine nucleotides and phosphate across reconstituted proteoliposomes under varying calcium concentrations. One effective approach involves radioisotope-based transport assays using liposomes reconstituted with purified slc25a25a protein. These proteoliposomes can be preloaded with internal substrate (e.g., 10 mM Pi) and then incubated with external radiolabeled substrates (e.g., [³²P]ATP-Mg) in the presence of different calcium concentrations ranging from nominal calcium (using EGTA chelation) to physiologically relevant concentrations (0.1-10 μM free Ca²⁺) . Transport activity can be quantified by measuring the uptake of radiolabeled substrate over time, with samples collected by rapid filtration through cellulose filters and analyzed by scintillation counting.

For more detailed kinetic analysis, researchers should employ a stopped-flow spectrofluorometric approach using fluorescently labeled ATP analogs (such as TNP-ATP) or by monitoring changes in pyranine fluorescence as an indicator of internal pH changes during transport. This method allows for real-time measurement of transport rates with millisecond resolution. To specifically characterize the calcium dependence of transport activity, a calcium titration series should be performed using precisely calculated free calcium concentrations buffered with EGTA/calcium mixtures. The transport data can be fitted to Hill equations to determine both the calcium sensitivity (EC₅₀) and cooperativity of calcium binding. Additionally, site-directed mutagenesis of specific EF-hand motifs can be employed to assess the contribution of individual calcium-binding sites to transport regulation. Combined with thermostability assays that measure conformational changes upon calcium binding, these approaches provide comprehensive characterization of slc25a25a's transport mechanism and its regulation by calcium .

What gene-editing strategies are most effective for functional studies of slc25a25a in zebrafish?

For functional studies of slc25a25a in zebrafish, CRISPR-Cas9 technology currently represents the most effective gene-editing strategy due to its high efficiency, specificity, and versatility. Implementation of this approach for slc25a25a studies should begin with careful guide RNA (gRNA) design targeting exons that encode critical functional domains, such as the EF-hand calcium-binding motifs or the mitochondrial carrier domain . Multiple gRNAs should be designed and tested to identify those with highest editing efficiency, preferably targeting early exons to ensure functional disruption. Cas9 protein can be co-injected with selected gRNAs into one-cell stage zebrafish embryos, followed by genotyping via T7 endonuclease assay or direct sequencing to identify founder fish carrying mutations. Established mutant lines should be maintained to homozygosity when viable, or as heterozygous carriers if homozygous mutations cause embryonic lethality.

For more nuanced functional studies, conditional knockout approaches using the Cre-loxP system can be employed to achieve tissue-specific or temporally controlled gene inactivation, which is particularly valuable for distinguishing between developmental and physiological functions of slc25a25a. Additionally, knock-in strategies to introduce specific mutations in calcium-binding domains or to create fluorescently tagged versions of slc25a25a provide powerful tools for structure-function analyses and protein localization studies. Complementary approaches include morpholino-based knockdown, which can be used for rapid preliminary assessment of gene function or to address potential compensation effects in stable mutant lines . Morpholinos targeting slc25a25a should be designed to block either translation (targeting the 5' UTR and start codon region) or pre-mRNA splicing (targeting exon-intron boundaries), with careful validation using RT-PCR and western blotting to confirm knockdown efficiency and specificity.

How does slc25a25a contribute to the TRPP2-dependent signaling pathway in zebrafish development?

Slc25a25a serves as a critical downstream effector in the TRPP2-dependent signaling pathway during zebrafish development, functioning as a molecular bridge between ciliary calcium signaling and mitochondrial metabolism. TRPP2 (also known as polycystin-2 or PKD2) is a calcium-permeable cation channel located in cilia that transduces mechanical or chemical signals into calcium influx. This calcium signal is then detected by the calcium-binding EF-hand motifs in the N-terminal domain of slc25a25a, which consequently alters its transport activity and influences mitochondrial ATP-Mg/Pi exchange . In zebrafish development, this signaling cascade is particularly important for establishing left-right asymmetry, a process that requires precise coordination of ciliary function, calcium signaling, and downstream gene expression patterns in the left-right organizer (Kupffer's vesicle).

The functional significance of slc25a25a in TRPP2-dependent signaling is evidenced by the similar phenotypes observed when either gene is disrupted. Loss of slc25a25b (the paralog of slc25a25a with well-characterized developmental functions) results in randomization of left-right asymmetry, mirroring the phenotype observed in TRPP2 (pkd2) mutants . Importantly, this phenotype occurs without affecting the number of cilia, ciliary length, or cilia-dependent directional flow generation in Kupffer's vesicle, indicating that slc25a25a/b acts downstream of the ciliary mechanosensation. The pathway connects ciliary calcium signaling to the regulation of gene expression, particularly affecting the Nodal signaling cascade. Knockdown of slc25a25b in zebrafish leads to randomization of southpaw (Nodal) expression in the lateral plate mesoderm and affects other members of the Nodal signaling cascade, including dand5 (Cerl2) and lefty2 . This signaling pathway represents an evolutionarily conserved mechanism that links environmental sensing (via cilia) to fundamental cellular processes through calcium-regulated mitochondrial metabolism.

What metabolic changes occur in response to slc25a25a activity in cellular models?

Slc25a25a activity induces specific metabolic signatures characterized by alterations in adenine nucleotide pools, energy metabolism, and related metabolic pathways. Studies of cells with deficient SLC25A25 or TRPP2 (the upstream regulator of SLC25A25) have revealed concordant changes in specific metabolites, with significant increases in some metabolites and decreases in others, providing insight into the metabolic consequences of slc25a25a activity . Most notably, ATP concentrations are reduced in both SLC25A25- and TRPP2-deficient cells, consistent with the role of the SCaMC/APC carrier family in modulating the adenine nucleotide pool in the mitochondrial matrix in response to changes in energy demands . This observation suggests that slc25a25a plays a crucial role in maintaining cellular energy homeostasis through its calcium-regulated transport activity.

The table below summarizes key metabolic changes observed in models with altered SLC25A25 activity:

Metabolite CategoryIncreased in SLC25A25 DeficiencyDecreased in SLC25A25 Deficiency
Energy MetabolitesAMP, ADPATP, Phosphocreatine
TCA CycleFumarate, MalateCitrate, α-Ketoglutarate
Amino AcidsGlutamine, AlanineAspartate, Glutamate
Lipid MetabolismSpecific AcylcarnitinesPhospholipid Precursors

These metabolic alterations reflect the importance of slc25a25a in mitochondrial adenine nucleotide transport and its broader impact on cellular metabolism. When calcium signaling activates slc25a25a, it enhances the exchange of ATP-Mg for phosphate across the mitochondrial inner membrane, thereby increasing matrix ATP levels and supporting mitochondrial functions that require ATP. This process is particularly important during periods of increased cellular energy demand or calcium signaling events. The connection between calcium signaling, slc25a25a activity, and metabolic alterations explains how disruptions in this pathway can lead to developmental abnormalities, such as defects in left-right patterning, which require precise coordination of cellular energetics and signaling pathways during critical developmental windows .

What are common challenges in generating stable slc25a25a mutant zebrafish lines?

Generating stable slc25a25a mutant zebrafish lines presents several significant challenges that researchers must address to establish reliable models for functional studies. One primary challenge stems from potential developmental lethality, as complete loss of slc25a25a function may result in embryonic death if the gene plays essential roles in early development. Given the importance of mitochondrial carriers in energy metabolism and the known roles of related proteins in critical developmental processes like left-right patterning, researchers often encounter reduced viability of homozygous mutants . This necessitates maintaining heterozygous carriers and carefully timing experimental interventions to study gene function before lethality occurs. Additionally, genetic compensation through upregulation of paralogous genes, particularly slc25a25b, may mask phenotypes in slc25a25a mutants, necessitating the generation of double mutants or the use of acute knockdown approaches to circumvent compensatory mechanisms.

Technical challenges in CRISPR-Cas9 genome editing for slc25a25a include off-target effects, which can be minimized through careful gRNA design and validation of multiple independent mutant lines. Mosaic mutations in F0 injected embryos also present difficulties in phenotype interpretation, requiring careful establishment and characterization of stable F2 homozygous lines. The presence of multiple splice variants, as observed in human SCaMC genes , further complicates mutant design, as targeting specific exons may not disrupt all functional protein isoforms. Researchers must carefully consider genomic structure and potential alternative splicing events when designing targeting strategies. Additionally, confirming the loss of protein expression presents challenges due to limited availability of specific antibodies against zebrafish slc25a25a, often requiring generation of custom antibodies or alternative approaches such as epitope tagging of the endogenous locus. Successful generation of informative slc25a25a mutant lines typically requires combining multiple complementary approaches, including conditional knockouts, paralog double mutants, and rescue experiments with wildtype or mutant versions of the protein.

How can researchers address data discrepancies between morpholino knockdown and genetic mutation of slc25a25a?

Data discrepancies between morpholino knockdown and genetic mutation approaches represent a common challenge in zebrafish research that requires systematic investigation and careful experimental design to resolve. When faced with such inconsistencies in slc25a25a studies, researchers should first validate the specificity and efficiency of both approaches. For morpholinos, this includes performing dose-dependent studies, using appropriate controls (including standard control morpholinos and rescue experiments with morpholino-resistant mRNA), and directly assessing target protein reduction via western blotting or immunofluorescence . For genetic mutants, researchers should sequence the targeted locus to confirm the exact nature of the mutation, assess the presence of potential in-frame products or alternative start sites that might lead to partially functional proteins, and verify protein loss through western blotting or immunohistochemistry.

Genetic compensation, a documented phenomenon in zebrafish genetic mutants but typically absent in acute morpholino knockdown, often underlies discrepancies between these approaches. Researchers should assess potential upregulation of paralogs (particularly slc25a25b) or functionally related genes in mutant lines using RNA-seq or qPCR approaches. The timing of gene function loss also differs between methods, with morpholinos causing immediate knockdown from fertilization while genetic compensation in mutants may develop over time, potentially explaining phenotypic differences. To address these issues, researchers can employ complementary approaches such as combinatorial targeting of multiple paralogs, heat-shock inducible CRISPR-Cas9 systems for temporal control of gene editing, or pharmacological inhibition of relevant pathways. When discrepancies persist, the combined phenotypic and molecular data from both approaches should be interpreted within a broader framework that considers the gene's function in relation to known developmental and physiological processes and related animal models. Publication of seemingly contradictory results, along with thorough documentation of methodological details, enables the research community to collectively resolve such discrepancies over time.

What strategies can overcome challenges in detecting calcium-dependent conformational changes in slc25a25a?

Detecting calcium-dependent conformational changes in slc25a25a presents significant technical challenges due to the protein's membrane localization, complex domain structure, and dynamic nature of calcium-induced conformational shifts. To overcome these obstacles, researchers should employ a multi-faceted approach combining several complementary techniques. Thermostability assays, which have been successfully used with human SLC25A25 , provide a valuable starting point by measuring the protein's melting temperature (Tm) under varying calcium concentrations. This approach can detect the biphasic unfolding profile characteristic of calcium-binding proteins, revealing distinct calcium-bound and calcium-free states. For more detailed structural insights, hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers advantages for membrane proteins by mapping regions that undergo conformational changes upon calcium binding with peptide-level resolution without requiring protein crystallization.

Fluorescence-based approaches provide powerful tools for real-time monitoring of conformational changes. Strategic introduction of environmentally sensitive fluorophores (such as BADAN or IAEDANS) at sites near calcium-binding domains through cysteine substitution mutagenesis allows detection of local conformational changes through shifts in fluorescence intensity or emission maxima upon calcium binding. Similarly, Förster resonance energy transfer (FRET) sensors can be engineered by introducing donor and acceptor fluorophores at positions predicted to change in proximity upon calcium binding. For cellular studies, split-GFP complementation systems can report on calcium-induced domain movements when fragments are attached to different regions of the protein. Advanced computational approaches aid in these experimental designs - molecular dynamics simulations of slc25a25a in calcium-bound and calcium-free states can predict conformational changes and guide selection of optimal sites for fluorophore attachment or mutation. Overcoming the inherent challenges in studying calcium-dependent conformational changes in this complex membrane protein ultimately requires integrating structural predictions with multiple complementary experimental approaches, each providing different but converging insights into the protein's calcium-dependent regulatory mechanism.

How might slc25a25a function in non-developmental contexts such as stress response or aging?

Beyond its established role in embryonic development, slc25a25a likely serves critical functions in non-developmental contexts such as cellular stress response and aging processes. As a calcium-regulated mitochondrial carrier, slc25a25a is strategically positioned to respond to calcium signaling events triggered by various stressors, including oxidative stress, metabolic perturbations, and environmental challenges. Under stress conditions, intracellular calcium fluctuations would modulate slc25a25a activity, potentially enhancing mitochondrial ATP uptake to support energy-dependent stress response mechanisms such as protein folding, DNA repair, and autophagy. This adaptive response would be particularly important in tissues with high energy demands and susceptibility to stress, including neurons, cardiomyocytes, and hepatocytes. The calcium-sensing capability of slc25a25a makes it an ideal candidate for coordinating mitochondrial metabolic adjustments during stress, where calcium signaling often serves as a primary stress-response pathway.

In the context of aging, slc25a25a may contribute to the progressive decline in mitochondrial function characteristic of senescent cells. Age-related alterations in calcium homeostasis, including elevated basal cytosolic calcium and impaired calcium buffering, would directly impact slc25a25a regulation, potentially leading to dysregulated mitochondrial nucleotide transport and compromised bioenergetic capacity. This hypothesis is supported by studies of mitochondrial carriers in aging models, which demonstrate altered expression and function with advancing age. Furthermore, given the role of slc25a25a in the TRPP2 signaling pathway , it may participate in age-related ciliary dysfunction, a phenomenon increasingly recognized as contributing to tissue deterioration in various organs. Investigation of slc25a25a expression and function in aged tissues, particularly in zebrafish models of accelerated aging, could reveal novel connections between calcium signaling, mitochondrial metabolism, and aging processes. Therapeutic strategies targeting slc25a25a regulation might offer approaches to enhance cellular resilience to stress and potentially attenuate age-related mitochondrial dysfunction in conditions characterized by aberrant calcium signaling.

What potential interactions exist between slc25a25a and other mitochondrial transporters or calcium channels?

The functional interplay between slc25a25a and other mitochondrial transporters or calcium channels creates a sophisticated network for coordinating cellular energy metabolism with calcium signaling. While direct physical interactions between slc25a25a and other transporters remain largely unexplored, functional coupling likely occurs through shared metabolic substrates and interconnected regulatory mechanisms. Potential interacting partners include members of the mitochondrial carrier family that transport related substrates, such as the adenine nucleotide translocase (ANT/SLC25A4-6) that exchanges matrix ATP for cytosolic ADP. This functional coupling would create an integrated system for adenine nucleotide homeostasis, where slc25a25a mediates calcium-regulated ATP-Mg/Pi exchange while ANT handles constitutive ATP/ADP exchange for oxidative phosphorylation. Similarly, the phosphate carrier (PiC/SLC25A3) likely functions in concert with slc25a25a, as phosphate released by slc25a25a in exchange for ATP-Mg could be subsequently transported back into the matrix by PiC to support ATP synthesis.

On the calcium signaling side, slc25a25a may functionally interact with various calcium channels and transporters that shape mitochondrial calcium dynamics. The mitochondrial calcium uniporter (MCU) complex, which mediates calcium uptake into the mitochondrial matrix, could indirectly influence slc25a25a activity through its effects on matrix calcium levels and downstream metabolic processes. Voltage-dependent anion channels (VDACs) at the outer mitochondrial membrane constitute another potential interacting partner, as they control the flux of metabolites and ions, including calcium, between the cytosol and the intermembrane space where slc25a25a's calcium-sensing domain is located. At the ciliary membrane, TRPP2 channels have been established as upstream regulators of slc25a25 function , but potential interactions with other TRP channels or calcium-handling proteins remain to be explored. These multifaceted interactions would allow slc25a25a to integrate information from multiple calcium signaling pathways and coordinate appropriate bioenergetic responses across different cellular compartments and under varying physiological conditions.

How might slc25a25a be targeted for therapeutic applications in mitochondrial disorders?

Targeting slc25a25a for therapeutic applications in mitochondrial disorders represents an emerging frontier with significant potential for addressing conditions characterized by impaired energy metabolism and calcium dysregulation. The calcium-regulated transport function of slc25a25a offers multiple intervention points, including modulation of calcium sensitivity, transport activity, and protein expression levels. Small molecule modulators that bind to the calcium-sensing EF-hand domains could be developed to enhance calcium sensitivity in conditions with defective calcium signaling or to reduce hypersensitivity in disorders with calcium overload. Similarly, compounds targeting the carrier domain could be designed to enhance ATP-Mg/Pi exchange in conditions with ATP depletion, helping to maintain mitochondrial nucleotide pools and support energy-dependent cellular processes. These approaches would require high-throughput screening platforms using reconstituted slc25a25a in liposomes or engineered cellular systems with calcium-responsive readouts to identify and optimize lead compounds.

Gene therapy approaches offer another promising avenue, particularly for disorders caused by mutations in slc25a25a or related genes in the calcium-mitochondria signaling axis. Adeno-associated virus (AAV) vectors carrying wildtype slc25a25a or engineered variants with enhanced activity could be developed for delivery to affected tissues. For developmental disorders linked to TRPP2-slc25a25a signaling defects, early intervention would be crucial, potentially using in utero gene therapy approaches in severe cases. Alternatively, antisense oligonucleotides or RNA interference strategies could be employed to modulate slc25a25a expression levels in conditions where either deficiency or excess contributes to pathology. Beyond direct targeting, interventions addressing downstream metabolic consequences of slc25a25a dysfunction represent pragmatic near-term approaches. Metabolomics studies of SLC25A25-deficient cells have identified specific metabolite alterations , providing potential biomarkers for patient stratification and targets for metabolic therapies aimed at normalizing these disruptions. As our understanding of slc25a25a's role in mitochondrial homeostasis and development expands, these therapeutic approaches may extend to a broader range of conditions, including ciliopathies, neurodegenerative diseases, and metabolic disorders where calcium-mitochondria signaling plays a central pathophysiological role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.