Recombinant Danio rerio CD99 antigen-like protein 2 (cd99l2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cd99l2; CD99 antigen-like protein 2; CD antigen CD99
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-252
Protein Length
Full Length of Mature Protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cd99l2
Target Protein Sequence
DGLDLADALGDDDDDEPTTKPPKADPGAGGAGGAAVKPTLKPVKPTVKEPAKPKPKQTGL DDFDLADALNPDNDIKGKGKDSGKGDKEVGGGSRDDGTPNSRGSQFSDDDLLDVGNDNSY KPDKGKGGKGGSSSNVGDLDPADDNNYDTMAETGTIAGIVSAVAMALVGAVSSYISYQKK KLCFSIQQSLNADMVKADAPDAVVAQEPQVQQTLLQPPNAEPPTEENAV
Uniprot No.

Target Background

Function

May function as a homophilic adhesion molecule.

Database Links

KEGG: dre:323266

UniGene: Dr.75649

Protein Families
CD99 family
Subcellular Location
Cell membrane; Single-pass type I membrane protein; Extracellular side. Cell junction.

Q&A

What is CD99L2 in zebrafish and how does it compare to mammalian orthologues?

Structurally, zebrafish CD99L2 is characterized by:

  • A type I transmembrane glycoprotein structure

  • Expression across multiple tissues

  • Conserved acidic motifs shared with other CD99 family members

Unlike human CD99L2, which has multiple isoforms including long forms (E3'-E4'-E3-E4) and shorter variants, the zebrafish protein appears to have fewer documented splice variants, though alternate splicing likely occurs .

What expression patterns does cd99l2 show during zebrafish development?

Studies using RNA probe hybridization techniques reveal that cd99l2 is prominently expressed in the central nervous system during zebrafish embryonic development . To investigate this expression pattern, researchers have successfully employed whole-mount in situ hybridization techniques.

Methodological approach for expression analysis:

  • Cloning the cd99l2 fragment obtained by RT-PCR into pGM-T Easy

  • Linearizing plasmids with restriction enzymes (SacII or SalI)

  • Synthesizing digoxigenin-labeled antisense and sense probes using Sp6 or T7 RNA polymerase

  • Performing whole-mount in situ hybridization to visualize expression patterns

Results show intense expression in the central nervous system during developmental stages, suggesting an important role beyond immune function in early development .

What are the recommended storage conditions for recombinant zebrafish CD99L2 protein?

Based on manufacturer protocols, optimal storage conditions for recombinant Danio rerio CD99L2 are as follows:

Storage ParameterRecommended Condition
Short-term storage4°C for up to one week
Long-term storage (liquid form)-20°C/-80°C for 6 months
Long-term storage (lyophilized form)-20°C/-80°C for 12 months
Freeze-thaw cyclesAvoid repeated freezing and thawing

For reconstitution of lyophilized protein:

  • Briefly centrifuge vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

  • Default recommended glycerol concentration is 50%

What is the role of CD99L2 in zebrafish immune response?

CD99L2 functions as an adhesion molecule that plays a critical role in leukocyte migration during immune responses in zebrafish. Recent research utilizing TALEN (transcription activator-like effector nuclease) gene knockout techniques has revealed its specific functions:

  • Leukocyte recruitment: CD99L2 is involved in the recruitment of granulocytes and macrophages to wounded tissue following caudal fin damage .

  • Interstitial migration: Using transgenic zebrafish lines with labeled vasculature, neutrophils, and macrophages, researchers demonstrated that CD99L2 facilitates leukocyte migration through interstitial spaces to wound sites .

  • Molecular signaling: RNA-seq analysis of cd99l2 mutants showed enrichment in RNA transcription, protein folding, and P450 pathway functions, suggesting CD99L2 may participate in cascade signaling pathways as an adhesion molecule .

How can knockout models of cd99l2 in zebrafish be generated and what phenotypes have been observed?

Generation of cd99l2 knockout zebrafish models has been successfully accomplished using TALEN (transcription activator-like effector nuclease) technology. The established methodology includes:

Generation protocol:

  • Design of TALEN constructs targeting specific regions of the cd99l2 gene

  • Microinjection of TALEN mRNA into one-cell stage zebrafish embryos

  • Screening of F0 founders for germline transmission of mutations

  • Establishment of stable mutant lines through selective breeding

Observed phenotypes in cd99l2 knockout zebrafish:

  • Normal development: Interestingly, deletion of cd99l2 did not affect normal zebrafish development .

  • Impaired immune response: Following caudal fin damage, mutants showed significantly reduced recruitment of granulocytes and macrophages to wounded tissue .

  • Altered gene expression: Expression of mfap4 (microfibrillar-associated protein 4) was drastically decreased in cd99l2 mutants, potentially explaining impaired macrophage migration to wound sites .

  • Molecular pathway alterations: RNA-seq analysis revealed enrichment of RNA transcription, protein folding, and P450 pathway genes in mutants .

What methods are most effective for studying CD99L2-mediated leukocyte migration in zebrafish models?

Several complementary approaches have proven effective for investigating CD99L2-mediated leukocyte migration in zebrafish:

In vivo imaging techniques:

  • Transgenic reporter lines: Utilizing transgenic zebrafish with fluorescently labeled vasculature, neutrophils, and macrophages enables real-time visualization of leukocyte migration .

  • Confocal microscopy: High-resolution imaging of leukocyte extravasation and interstitial migration.

  • Time-lapse analysis: Tracking individual cell movement patterns and velocities.

Experimental injury models:

  • Caudal fin amputation: A standardized model that allows quantification of leukocyte recruitment to wounded tissue .

  • Tailfin transection: Enables observation of neutrophil and macrophage migration kinetics.

Molecular and functional analysis:

  • qRT-PCR analysis: For quantifying changes in expression of related genes, such as the observed downregulation of mfap4 in cd99l2 mutants .

  • RNA-seq: For comprehensive transcriptional profiling, revealing downstream effects of CD99L2 deficiency .

  • Whole-mount in situ hybridization: For spatial expression analysis of cd99l2 and related genes during development and immune responses .

The integration of these methodologies provides comprehensive insights into the molecular mechanisms and functional consequences of CD99L2-mediated leukocyte migration.

How does recombinant zebrafish CD99L2 compare to mammalian CD99L2 in functional assays?

Comparative functional studies between zebrafish and mammalian CD99L2 reveal both similarities and differences:

Structural comparisons:

SpeciesAmino Acid Homology with Zebrafish CD99L2Key Functional Domains
Human51%Three conserved acidic motifs
Mouse44%Type I transmembrane structure
Rat43%Extracellular domain for adhesion

Functional similarities:

  • Leukocyte extravasation: Both zebrafish and mammalian CD99L2 play crucial roles in leukocyte migration across endothelial barriers .

  • Adhesion molecule function: Both act as adhesion molecules facilitating cell-cell interactions .

  • Inflammatory response: Both participate in the recruitment of leukocytes to sites of inflammation .

Key differences:

  • Expression patterns: While mammalian CD99L2 shows low expression in thymus , zebrafish cd99l2 shows intense expression in the central nervous system during development .

  • Isoform diversity: Human CD99L2 has multiple documented isoforms , whereas fewer variant transcripts have been characterized in zebrafish.

These comparative insights suggest that while the core immune functions of CD99L2 are conserved across species, there may be species-specific adaptations in expression patterns and regulatory mechanisms.

What are the optimal expression systems for producing functional recombinant zebrafish CD99L2?

Different expression systems have been employed for producing recombinant Danio rerio CD99L2, each with distinct advantages:

Expression system comparison:

Expression SystemAdvantagesLimitationsReported Yield
E. coliCost-effective, high yield, ease of scale-upLimited post-translational modifications, potential inclusion bodiesVariable depending on optimization
Mammalian cellsProper folding, post-translational modificationsHigher cost, lower yieldProduces properly glycosylated protein
YeastBalance of cost and post-translational modificationsSpecies-specific glycosylation patterns>85% purity (SDS-PAGE)

Recommended methodological approach:

  • For structural studies: E. coli expression system with optimization for soluble protein production .

  • For functional studies: Mammalian cell expression system to ensure proper folding and post-translational modifications .

  • For large-scale production: Yeast expression system offering a balance of cost-effectiveness and protein quality .

Purification strategies:

  • Affinity chromatography: Using His-tag technology (N-terminal 10xHis-tag or C-terminal 6xHis-tag) .

  • Size exclusion chromatography: For further purification and buffer exchange.

  • Quality control: SDS-PAGE analysis to confirm purity (>85% recommended) .

The choice of expression system should align with the intended experimental application, with mammalian cell-derived protein generally preferred for functional studies.

How can recombinant CD99L2 be used to study wound healing mechanisms in zebrafish models?

Recombinant CD99L2 offers valuable research opportunities for investigating wound healing in zebrafish, particularly in the context of immune cell recruitment and tissue regeneration:

Experimental approaches:

  • Caudal fin regeneration model: The zebrafish caudal fin amputation model provides an excellent system for studying wound healing and regeneration processes .

  • Leukocyte recruitment analysis: Quantifying neutrophil and macrophage migration to wound sites using transgenic reporter lines in the presence or absence of CD99L2 function .

  • Gene expression analysis: Examining the regulation of wound healing genes such as sonic hedgehog (shh), insulin-like growth factor 2a (igf2a), bone morphogenetic protein 2b (bmp2b), and collagen 1a2 (col1a2) .

Research applications:

  • Blocking studies: Using recombinant CD99L2 as a competitive inhibitor to block endogenous CD99L2 function during wound healing.

  • Rescue experiments: Administering recombinant CD99L2 to cd99l2-mutant zebrafish to assess functional recovery of immune cell migration.

  • Investigation of pathological conditions: Studying CD99L2 function in models of impaired wound healing, such as hyperglycemia-induced delayed healing .

Recent research has demonstrated that hyperglycemic conditions significantly impair caudal fin regeneration and wound healing gene expression in zebrafish , providing a model system where CD99L2's role in leukocyte migration and wound healing can be investigated under pathological conditions.

What are the technical challenges in analyzing CD99L2 protein-protein interactions in zebrafish models?

Investigating CD99L2 protein-protein interactions in zebrafish presents several technical challenges that require specialized approaches:

Key challenges and solutions:

  • Membrane protein solubilization:

    • Challenge: CD99L2 is a single-pass transmembrane protein, making solubilization while maintaining native conformation difficult.

    • Solution: Optimize detergent screening (mild non-ionic detergents like DDM or LMNG) for extraction while preserving protein-protein interactions.

  • Limited antibody availability:

    • Challenge: Few commercially available antibodies specifically target zebrafish CD99L2.

    • Solution: Development of custom antibodies or use of epitope tagging approaches (His-tag, FLAG-tag) in recombinant proteins .

  • In vivo visualization:

    • Challenge: Visualizing protein interactions in living zebrafish embryos.

    • Solution: Implement fluorescence resonance energy transfer (FRET), bimolecular fluorescence complementation (BiFC), or proximity ligation assay (PLA) technologies.

  • Identifying binding partners:

    • Challenge: Comprehensive identification of CD99L2 interactors in zebrafish.

    • Solution: Employ co-immunoprecipitation followed by mass spectrometry, or yeast two-hybrid screening with zebrafish-specific libraries.

  • Validation of interactions:

    • Challenge: Confirming the biological relevance of identified interactions.

    • Solution: Utilize CRISPR/Cas9 or TALEN-mediated mutagenesis of interaction domains followed by functional assays of leukocyte migration.

  • Tissue-specific interactions:

    • Challenge: CD99L2 may have different binding partners in different tissues.

    • Solution: Implement tissue-specific promoters for expression of tagged proteins and/or tissue-specific isolation techniques.

Understanding these protein-protein interactions is critical for elucidating the molecular mechanisms through which CD99L2 regulates leukocyte migration in normal and pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.