Recombinant Danio rerio Cholesterol 25-hydroxylase-like protein (ch25h)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

These enzymes exhibit conserved roles across species, including:

Cholesterol Hydroxylation

ch25h catalyzes the oxidation of cholesterol to 25HC, a bioactive oxysterol that regulates lipid homeostasis and immune responses . In zebrafish, this activity is linked to:

  • Antiviral Defense: 25HC inhibits viral entry by modulating membrane cholesterol, restricting fusion and replication of enveloped viruses (e.g., SARS-CoV-2, cyprinid herpesvirus 3) .

  • Inflammation Modulation: 25HC suppresses mitochondrial DNA release and AIM2 inflammasome activation, mitigating excessive inflammation .

Tissue-Specific Expression

In non-zebrafish models (e.g., Chinese tongue sole), ch25h expression is highest in skin and muscle, suggesting roles beyond liver-mediated lipid metabolism . Gender-specific regulation is observed in gonads, with dietary arachidonic acid (ARA) upregulating ch25h in testes but not ovaries .

Antiviral Mechanisms

Studies in fish cells demonstrate that:

VirusEntry Mechanism25HC EffectSources
CyHV-3 (herpesvirus)Lipid raft-dependentBlocks viral entry
SVCV (rhabdovirus)Clathrin-mediated endocytosisInhibits replication
IPNV (birnavirus)MacropinocytosisReduces viral internalization

Lipid Metabolism and Inflammation

  • Cholesterol Homeostasis: 25HC represses sterol regulatory element-binding protein (SREBP) processing, balancing cholesterol synthesis .

  • Efferocytosis: In mammals, ch25h deficiency impairs macrophage clearance of apoptotic cells, exacerbating inflammation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
ch25h; zgc:101688; Cholesterol 25-hydroxylase-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
ch25h
Target Protein Sequence
MFGLQHIWDCILQYEAQLRSPFFPVLFSITVYLSFCLPFVLLDALSPKVELIRRYKIQQK ASVSWTMMWSCLALSLYNHVVYIFPLSVLHWYWRPVSYLAEAPGVLRVVWDLAACLLLFD FQYFVWHLLHHKVPWLYRTFHKVHHKYTSTFALATEYSGAWETLSLGFFAAVNPMLLGVH PMTEMLFHMLNMWLSVEDHCGYDLPWATHRLMPFGLYGGAPHHDVHHQKFKSNYAPYFTH WDKLFGTLHFE
Uniprot No.

Target Background

Function

This recombinant Danio rerio Cholesterol 25-hydroxylase-like protein (ch25h) catalyzes the conversion of cholesterol to 25-hydroxycholesterol, subsequently repressing cholesterol biosynthetic enzymes. It plays a crucial role in cell positioning and movement within lymphoid tissues. 25-hydroxycholesterol serves as an intermediate in 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) biosynthesis. 7-alpha,25-OHC acts as a ligand for the G protein-coupled receptor GPR183/EBI2, a chemotactic receptor for various lymphoid cells. This protein may also significantly regulate lipid metabolism by synthesizing a corepressor that inhibits sterol regulatory element binding protein (SREBP) processing. In the testis, macrophage-produced 25-hydroxycholesterol may contribute to Leydig cell differentiation.

Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of ch25h genes in Danio rerio?

Zebrafish (Danio rerio) possess five distinct ch25h genes in their genome, representing a more complex genetic landscape than mammals. These genes exhibit differential tissue expression patterns and varied responses to immune stimulation. Phylogenetic and synteny analyses have identified ch25hb as the putative homolog of mammalian Ch25h, while the remaining zebrafish ch25h genes appear to be products of duplications within the teleost lineage . This genomic complexity offers opportunities to study divergent functions of ch25h subtypes in vertebrate evolution.

How does zebrafish ch25h differ structurally and functionally from mammalian orthologs?

Zebrafish ch25h, particularly ch25hb, shares moderate sequence identity with orthologs in other teleosts but shows lower identity to human CH25H. Despite these differences, the protein maintains its fundamental enzymatic function of converting cholesterol to 25-hydroxycholesterol (25HC). A key functional difference lies in its regulation - unlike mammalian CH25H, which is strongly induced by interferons, zebrafish ch25hb is regulated through interferon-independent mechanisms . This suggests evolutionary divergence in regulatory pathways while preserving the core catalytic function.

What methods are most effective for identifying all ch25h paralogs in Danio rerio?

The identification of all five ch25h paralogs in zebrafish requires a comprehensive approach combining bioinformatics and molecular techniques. Initial identification typically employs BLAST searches using known ch25h sequences against the zebrafish genome, followed by synteny analysis to confirm orthologous relationships. RT-PCR with paralog-specific primers designed to unique regions can validate expression of predicted genes. For functional confirmation, measuring the enzymatic activity of each recombinant protein by quantifying 25HC production through LC-MS/MS provides definitive evidence of genuine ch25h paralogs .

How can researchers overcome challenges in maintaining enzymatic activity of recombinant ch25h?

Maintaining the enzymatic activity of recombinant ch25h requires attention to several critical factors. First, buffer composition is crucial - inclusion of glycerol (approximately 15%) helps stabilize the protein structure, while the presence of reducing agents like DTT (1mM) protects essential thiol groups. Second, the diiron cofactor must be properly incorporated, which may require supplementation with iron during expression or reconstitution during purification. Finally, storage conditions significantly impact activity retention - snap freezing in single-use aliquots and storage at -80°C prevents activity loss from freeze-thaw cycles . Validation of enzymatic activity should be performed by measuring the conversion of cholesterol to 25HC using LC-MS/MS.

What evidence supports the interferon-independent antiviral activity of zebrafish ch25h?

Compelling evidence demonstrates that zebrafish ch25h exhibits antiviral activity through interferon-independent mechanisms, contrasting with mammalian systems. When zebrafish were challenged with Spring Viremia Carp Virus (SVCV), in vivo overexpression of ch25hb significantly reduced mortality. Additionally, direct application of 25HC to the zebrafish cell line ZF4 negatively affected viral replication . Critically, studies showed that immune stimulation with LPS, PolyI:C, and SVCV induced ch25hb expression, but this upregulation was not mediated by type I interferons, unlike in mammals. This represents the first demonstration of interferon-independent antiviral activity of 25HC in a non-mammalian species, expanding our understanding of evolutionary divergence in antiviral mechanisms.

How does 25HC produced by zebrafish ch25h inhibit viral replication?

The 25-hydroxycholesterol (25HC) produced by zebrafish ch25h appears to inhibit viral replication through multiple mechanisms, similar to but distinct from those observed in mammalian systems. 25HC likely alters membrane composition, preventing viral fusion with host cell membranes. Additionally, 25HC may interfere with cholesterol-dependent viral assembly processes within infected cells . This dual mechanism of action effectively restricts viral replication at multiple stages of the viral life cycle. Experiments with SVCV in zebrafish cell lines demonstrated significant reduction in viral replication when 25HC was administered, supporting a direct antiviral effect. The mechanism appears to involve both protection of uninfected cells and direct interaction with viral components .

How do the five zebrafish ch25h paralogs differ in tissue distribution and expression patterns?

The five zebrafish ch25h paralogs exhibit distinct tissue distribution patterns, suggesting functional specialization. Ch25hb, the putative ortholog of mammalian CH25H, shows broad expression across multiple tissues but is particularly abundant in immune-relevant organs. In contrast, the other paralogs display more tissue-restricted expression patterns. Following immune challenge with LPS, PolyI:C, or SVCV, only ch25hb showed significant upregulation, while the other paralogs remained relatively unchanged . This differential response to immune stimulation suggests that ch25hb has evolved specialized immune functions, while the other paralogs may serve roles in basal cholesterol metabolism or other physiological processes.

How can structural and functional differences between zebrafish and mammalian ch25h inform drug discovery?

The structural and functional differences between zebrafish and mammalian ch25h provide valuable opportunities for drug discovery. The zebrafish system offers unique advantages for screening compounds that specifically target ch25h enzymatic activity or its regulation. By comparing the active sites of zebrafish ch25hb with human CH25H, researchers can identify conserved regions crucial for enzymatic function versus species-specific domains. This comparative approach can guide the design of broad-spectrum modulators targeting conserved regions or species-specific inhibitors. Additionally, the interferon-independent regulation of zebrafish ch25hb offers pathways for enhancing antiviral responses that bypass traditional interferon signaling, which could be valuable for developing therapies against viruses that suppress interferon responses .

What zebrafish models are most appropriate for studying ch25h function in vivo?

Several zebrafish models offer valuable approaches for studying ch25h function in vivo. Transient overexpression models using mRNA injection at the one-cell stage provide rapid assessment of ch25h effects on early development and response to viral challenge. For long-term studies, stable transgenic lines with tissue-specific promoters driving ch25h expression allow investigation of tissue-specific effects. CRISPR/Cas9-generated knockout lines for each ch25h paralog are essential for loss-of-function studies, with particular attention to ch25hb as the putative functional ortholog of mammalian CH25H . Notably, viral challenge experiments in these models have demonstrated that overexpression of ch25hb significantly reduces mortality following SVCV infection, confirming its antiviral role in vivo.

How can researchers effectively design experiments to distinguish the unique functions of each zebrafish ch25h paralog?

Designing experiments to distinguish the unique functions of each zebrafish ch25h paralog requires a multifaceted approach. First, generating paralog-specific knockout lines using CRISPR/Cas9 enables assessment of non-redundant functions through phenotypic analysis and challenge studies. Second, tissue-specific expression analysis using qRT-PCR with paralog-specific primers across diverse tissues and developmental stages can reveal specialized expression patterns. Third, stimulation experiments using various immune activators (LPS, PolyI:C, SVCV) followed by paralog-specific expression analysis can identify differential responses to immune challenges . Finally, rescue experiments in knockout backgrounds can determine functional redundancy between paralogs. For biochemical characterization, recombinant expression of each paralog followed by enzymatic activity assays and substrate specificity analysis can reveal functional diversification at the protein level.

How can the zebrafish ch25h system be leveraged for high-throughput screening of antiviral compounds?

The zebrafish ch25h system offers an excellent platform for high-throughput screening of antiviral compounds through multiple approaches. Embryo-based assays can be established where zebrafish embryos expressing fluorescently tagged ch25h are exposed to compound libraries, followed by automated imaging to detect changes in expression or localization. Additionally, cell-based assays using zebrafish cell lines (e.g., ZF4) can be developed where 25HC production is measured after compound treatment, either by mass spectrometry or using reporter systems responsive to 25HC . For direct antiviral screening, embryos or cells can be pretreated with compounds, challenged with viruses like SVCV, and viral replication quantified. The advantage of using zebrafish includes the ability to rapidly transition promising compounds from in vitro to in vivo validation, bridging the gap between cell culture and mammalian studies.

What are the potential applications of recombinant zebrafish ch25h in studying non-antiviral functions of oxysterols?

Recombinant zebrafish ch25h holds significant potential for studying non-antiviral functions of oxysterols, particularly in developmental biology and metabolism. The zebrafish model allows visualization of oxysterol effects throughout development in a vertebrate system. Studies suggest that 25HC may play roles in lipid metabolism, inflammation regulation, and potentially reproductive functions, as evidenced by high ch25h expression in gonads . Recombinant ch25h can be used to produce 25HC for controlled exposure studies examining effects on embryonic development, organogenesis, and neural development. Additionally, the zebrafish model permits investigation of oxysterol signaling through liver X receptors (LXRs) and their downstream effects on cholesterol homeostasis and immune modulation, with direct visualization capabilities not available in mammalian systems .

How might gender-specific differences in ch25h expression inform research on sex-dependent immune responses?

Research in teleost species has revealed intriguing gender-specific differences in ch25h expression that may inform broader understanding of sex-dependent immune responses. In Chinese tongue sole, a marine teleost, ch25h exhibited gender-dependent responses to dietary arachidonic acid (ARA), with high ARA levels significantly increasing ch25h transcription in male gonads and brain, but not affecting females . These findings suggest potential roles for ch25h in gender-specific immune or metabolic regulation. For zebrafish research, these observations warrant investigation into whether similar gender differences exist in ch25h expression or activity, particularly in response to immune challenges. Such studies could provide insights into the evolutionary basis of sex-dependent immune responses and potentially inform gender-specific approaches to immunomodulatory therapies targeting the ch25h pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.