Recombinant Danio rerio Claudin-7-A (cldn7a)

Shipped with Ice Packs
In Stock

Description

Biochemical Characteristics

Recombinant cldn7a is a full-length protein (1–212 amino acids) expressed in E. coli or mammalian systems. Key features include:

ParameterValueSource
Molecular WeightNot explicitly stated (calculated from AA sequence: ~24 kDa)
Amino Acid SequenceMANSGVQLLGFGLSLIGIIGLIVGTILPQWKMSAYVGDSIITAVATYQGLWMSCAFQSTGQLQCKIYDSILQLDSDLQATRALMIVGIIVSIAGLGVASIGMKCTTCGADDKVRKTRTAMTGGIILLVGALCAVVACSWFAHNVIRAFYNPFTPVNTKFEFGAAIFIAWGGSFLDVLGGAMLAASCPRSKQVSKYPKSNSTRSANGSNKEYV
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Endotoxin Level<1.0 EU/μg
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 (lyophilized) or PBS buffer

Production Methods

Recombinant cldn7a is synthesized using bacterial or mammalian expression systems:

SystemAdvantagesLimitationsSource
E. coliHigh yield, cost-effectivePotential improper folding
Mammalian CellsProper post-translational modificationsLonger production time, higher cost
  • Expression Hosts: E. coli (most common) and mammalian cells (e.g., CHO or HEK293) .

  • Purification: Affinity chromatography (via His-tag) .

Research Applications

Recombinant cldn7a is utilized in studies investigating tight junction (TJ) function, intestinal stem cell regulation, and cancer biology:

Intestinal Stem Cell Regulation

Claudin-7 knockout in mice leads to intestinal epithelial damage, impaired stem cell survival, and disrupted Wnt/β-catenin signaling. Recombinant cldn7a has been used to:

  • Rescue defects in Cldn7-deficient organoid cultures .

  • Study TJ-dependent regulation of crypt stem cell self-renewal and differentiation .

Cancer Models

Claudin-7 is implicated as a tumor suppressor in colorectal cancer. Recombinant cldn7a aids in:

  • Modeling intestinal adenoma formation in inducible knockout mice .

  • Investigating TJ disruption in oncogenesis .

Functional Assays

  • ELISA: Quantitative analysis of cldn7a expression in zebrafish tissues or cell lines .

  • Immunoblotting: Validation of protein expression and localization .

Role in Wnt/β-Catenin Signaling

  • Cldn7 deletion in mice disrupts Wnt/β-catenin signaling, leading to crypt stem cell apoptosis and defective epithelial differentiation .

  • Exogenous cldn7a supplementation restores stem cell survival in organoid cultures .

Tumor Suppression

  • Cldn7 knockout in mice induces intestinal inflammation, atypical hyperplasia, and adenoma formation, suggesting its role in preventing colorectal cancer .

Subcellular Localization

  • In renal tissues, cldn7a localizes predominantly to the basolateral membrane, contrasting with claudin-8’s tight junction localization .

Table 1: Recombinant cldn7a Production Systems

ParameterE. coli SystemMammalian Cells System
YieldHighModerate
Post-Translational ModificationsNoneGlycosylation, phosphorylation
ApplicationsStructural studies, ELISAFunctional assays, signaling studies

Table 2: Functional Implications of cldn7a in Disease Models

ModelPhenotypeMechanismSource
Cldn7 KO MiceIntestinal ulceration, stem cell lossDisrupted Wnt/β-catenin signaling
Inducible KO MiceAdenoma formation, hyperplasiaTJ barrier compromise, inflammation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference when placing your order, and we will fulfill it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cldn7a; zgc:92192; Claudin-7-A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-212
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cldn7a
Target Protein Sequence
MANSGVQLLGFGLSLIGIIGLIVGTILPQWKMSAYVGDSIITAVATYQGLWMSCAFQSTG QLQCKIYDSILQLDSDLQATRALMIVGIIVSIAGLGVASIGMKCTTCGADDKVRKTRTAM TGGIILLVGALCAVVACSWFAHNVIRAFYNPFTPVNTKFEFGAAIFIAWGGSFLDVLGGA MLAASCPRSKQVSKYPKSNSTRSANGSNKEYV
Uniprot No.

Target Background

Function
Claudin-7-A plays a crucial role in the tight junction-specific obliteration of the intercellular space.
Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is Claudin-7-A and what is its significance in zebrafish?

Claudin-7-A (cldn7a) is one of the tight junction proteins expressed in zebrafish (Danio rerio). Tight junction proteins form barriers in mature epithelia and participate in vertebrate morphogenesis. Claudins in zebrafish are expressed after gastrulation with remarkable specificity in structures such as otic and lateral-line placodes during their earliest developmental stages . Claudin-7-A belongs to a larger family, with zebrafish possessing approximately 15 claudin genes that have expanded along the chordate stem lineage . The full-length protein consists of 212 amino acids and plays crucial roles in maintaining epithelial integrity.

How does Claudin-7 function in epithelial tissues?

Claudin-7 functions as a critical component of tight junctions in epithelial tissues. These junctions are essential for maintaining the barrier function and polarity of epithelial cells. Based on research evidence, Claudin-7 not only forms barriers in mature epithelia but also participates in vertebrate morphogenesis . In zebrafish, Claudin-7 expression in specific tissues like otic and lateral-line placodes suggests its importance in the development of sensory structures . The protein plays essential roles in regulating paracellular permeability and maintaining epithelial integrity across various tissues.

What experimental models can be used to study Claudin-7-A function?

Several experimental models can be employed to study Claudin-7-A function:

  • Zebrafish knockout/knockdown models: Using technologies like CRISPR-Cas9 or morpholino oligonucleotides to create Claudin-7-A deficient zebrafish.

  • Cell culture systems: Establishing cell lines with Claudin-7-A knockdown or overexpression to study its function in vitro.

  • Recombinant protein studies: Using purified recombinant Claudin-7-A protein to study protein-protein interactions or structural analyses .

  • Transgenic reporter lines: Creating zebrafish lines with fluorescently tagged Claudin-7-A to visualize its expression patterns during development.

  • Xenograft models: Similar to studies with other claudins, Claudin-7-A function can be investigated using xenograft tumor models to assess its role in cancer development and progression .

These models provide complementary approaches to understand the complex functions of Claudin-7-A in development, physiology, and disease contexts.

How can I design experiments to study the role of Claudin-7-A in zebrafish development?

To study Claudin-7-A's role in zebrafish development, consider the following methodological approach:

  • Temporal expression analysis: Perform qPCR at different developmental timepoints to establish when Claudin-7-A is expressed. Design primers flanking intron positions observed in human genes to ensure specificity .

  • Spatial expression analysis: Conduct in situ hybridization to determine where Claudin-7-A is expressed during development, focusing on otic and lateral-line placodes where claudins are known to be expressed .

  • Loss-of-function studies: Create Claudin-7-A knockdown or knockout models using morpholino oligonucleotides or CRISPR-Cas9, then assess developmental phenotypes.

  • Gain-of-function studies: Overexpress Claudin-7-A by microinjecting mRNA and evaluate resulting developmental effects.

  • Rescue experiments: Perform rescue experiments in knockout/knockdown models by introducing wild-type or mutant forms of Claudin-7-A to verify specificity of observed phenotypes.

  • Live imaging: Use fluorescently tagged Claudin-7-A to visualize dynamic expression and localization during key developmental processes.

  • Molecular pathway analysis: Investigate interactions with signaling pathways such as Wnt/β-catenin, which has been linked to claudin function in other contexts .

What methods can be used to assess Claudin-7-A expression and localization?

Several complementary methods can be employed to assess Claudin-7-A expression and localization:

  • Quantitative PCR (qPCR): For measuring mRNA expression levels of cldn7a. Use primers that flank intron positions to ensure specificity .

  • Western blotting: To detect and quantify Claudin-7-A protein expression using specific antibodies.

  • Immunofluorescence staining: For visualizing the subcellular localization of Claudin-7-A in tissue sections or cultured cells .

  • In situ hybridization: To determine the spatial distribution of cldn7a mRNA in whole-mount zebrafish embryos or tissue sections.

  • Chromatin immunoprecipitation (ChIP): To study the regulation of cldn7a gene expression and identify transcription factors that bind to its promoter .

  • Coimmunoprecipitation (CoIP): To identify protein-protein interactions involving Claudin-7-A, such as its interaction with Sox9 as observed with other claudins .

  • Transgenic reporter lines: Creating zebrafish with fluorescent protein tags to monitor Claudin-7-A expression in vivo.

How does Claudin-7 deficiency affect cellular processes and signaling pathways?

Claudin-7 deficiency has significant effects on cellular processes and signaling pathways, particularly in epithelial tissues. Based on research in colorectal cancer models:

  • Wnt/β-catenin signaling: Claudin-7 deficiency activates the Wnt/β-catenin pathway, promoting the nuclear translocation of β-catenin and expression of downstream target genes .

  • Sox9-mediated mechanisms: Claudin-7 interacts with Sox9 at the protein level, and this interaction influences Wnt/β-catenin signaling .

  • Cell proliferation and apoptosis: Claudin-7 knockdown promotes cell proliferation and inhibits apoptosis, contributing to increased cell survival .

  • Cell migration and invasion: Deficiency in Claudin-7 enhances cell migration capabilities, potentially through epithelial-mesenchymal transition (EMT) mechanisms .

  • Stemness properties: Claudin-7 deficiency confers stemness properties to cells, enhancing their ability to form tumorspheres in serum-free media and generate xenograft tumors .

While these findings are primarily from colorectal cancer research, they provide insights into how Claudin-7-A may function in zebrafish tissues and development.

What is the relationship between Claudin-7-A and cancer research models?

Claudin-7-A has emerged as an important factor in cancer research models:

  • Tumor suppressor function: Evidence suggests that Claudin-7 functions as a tumor suppressor gene in colorectal cancer (CRC), with its deficiency promoting tumorigenesis .

  • Cancer stem cell properties: Claudin-7 deficiency promotes stemness properties in cancer cells, enhancing their ability to form tumorspheres and xenograft tumors .

  • Epithelial-mesenchymal transition: Loss of Claudin-7 promotes epithelial-mesenchymal transition, a process associated with increased cancer cell invasiveness and metastatic potential .

  • Wnt/β-catenin pathway modulation: Claudin-7 deficiency activates the Wnt/β-catenin pathway, which is frequently dysregulated in various cancers .

  • Zebrafish as cancer models: Zebrafish Claudin-7-A studies can serve as valuable models for understanding the role of tight junction proteins in human cancers, providing insights into potential therapeutic targets.

These connections make Claudin-7-A a valuable target for cancer research, particularly for understanding how tight junction proteins contribute to cancer development and progression.

How can Claudin-7-A function be investigated in the context of epithelial barrier formation?

Investigating Claudin-7-A function in epithelial barrier formation requires multi-dimensional approaches:

  • Transepithelial electrical resistance (TEER) measurements: Utilize TEER to quantify the integrity of epithelial barriers in cell culture models with manipulated Claudin-7-A expression.

  • Paracellular permeability assays: Measure the passage of differentially sized molecular tracers across epithelial monolayers to assess barrier function and selectivity.

  • Freeze-fracture electron microscopy: Visualize tight junction strand networks to evaluate the structural integrity of tight junctions in relation to Claudin-7-A expression.

  • Immunofluorescence colocalization studies: Examine the colocalization of Claudin-7-A with other tight junction proteins such as occludin and ZO-1 to understand its integration into the junction complex.

  • FRAP (Fluorescence Recovery After Photobleaching): Assess the dynamics of Claudin-7-A within the membrane to understand its mobility and integration into tight junctions.

  • Calcium switch assays: Monitor the reformation of tight junctions after calcium depletion and repletion to investigate the role of Claudin-7-A in de novo junction assembly.

  • Intestinal permeability studies: In zebrafish models, examine how Claudin-7-A affects intestinal barrier function using methods such as fluorescent dextran permeability assays .

What are the optimal storage and handling conditions for recombinant Claudin-7-A protein?

For optimal performance of recombinant Danio rerio Claudin-7-A protein, adhere to these storage and handling guidelines:

  • Storage temperature: Store at -20°C for regular use, or at -80°C for extended storage periods .

  • Buffer composition: The protein is typically stored in a Tris-based buffer with 50% glycerol, optimized specifically for this protein .

  • Aliquoting: Prepare working aliquots to avoid repeated freeze-thaw cycles, which can damage protein structure and function .

  • Working aliquots: Store working aliquots at 4°C for up to one week .

  • Freeze-thaw cycles: Minimize repeated freezing and thawing as this is not recommended for maintaining protein integrity .

  • Handling: When working with the protein, keep samples on ice when possible and avoid extended periods at room temperature.

  • Concentration: For experimental use, optimize protein concentration based on the specific application, starting with manufacturer recommendations.

Following these guidelines ensures the stability and activity of recombinant Claudin-7-A protein for experimental applications.

What PCR protocols are effective for studying Claudin-7-A gene expression?

Effective PCR protocols for studying Claudin-7-A gene expression include:

  • Primer design: Design primers flanking intron positions observed in human genes using tools like PRIMER3. This approach ensures specificity and helps distinguish between genomic DNA and cDNA amplification .

  • PCR conditions for genomic amplification:

    • Enzyme: 0.035 units/μl Amplitaq Gold or equivalent high-fidelity polymerase

    • Buffer: 1× Amplitaq Gold buffer

    • MgCl₂: 2.5 mM

    • dNTPs: 0.2 mM each

    • Primers: 0.8 μM each

    • Template: 2.5 ng/μl genomic DNA

    • Thermal cycling: 95°C for 10 min; 30 cycles of 94°C for 30s, 68°C for 30s, 72°C for 2 min; and 72°C for 3.5 min

  • Quantitative real-time PCR (qPCR):

    • Use SYBR Green or TaqMan-based detection systems

    • Include reference genes such as β-actin or GAPDH for normalization

    • Perform melt curve analysis to ensure specificity

    • Run reactions in triplicate for statistical reliability

  • RT-PCR for expression analysis:

    • Use high-quality RNA extraction methods optimized for zebrafish tissues

    • Include DNase treatment to eliminate genomic DNA contamination

    • Employ two-step RT-PCR with specific reverse transcription followed by PCR

  • Validation: Confirm PCR product specificity through sequencing or restriction enzyme analysis.

What methods can be used to purify recombinant Claudin-7-A protein?

Purification of recombinant Claudin-7-A protein requires specialized techniques due to its membrane protein nature:

  • Expression systems: Choose appropriate expression systems such as E. coli, insect cells, or mammalian cells depending on requirements for post-translational modifications.

  • Affinity chromatography: Utilize tag-based purification methods depending on the tag incorporated during production:

    • His-tag purification using nickel or cobalt resins

    • GST-tag purification using glutathione resins

    • FLAG-tag purification using anti-FLAG antibody resins

  • Detergent solubilization: Employ mild detergents like n-dodecyl-β-D-maltoside (DDM) or CHAPS to solubilize membrane proteins while maintaining native conformation.

  • Size exclusion chromatography: Further purify protein based on molecular size to remove aggregates and other impurities.

  • Ion exchange chromatography: Separate proteins based on charge differences using either cation or anion exchange resins.

  • Quality control measures:

    • SDS-PAGE with Coomassie or silver staining to assess purity

    • Western blotting to confirm identity

    • Mass spectrometry for precise molecular weight determination

    • Circular dichroism to evaluate secondary structure integrity

  • Buffer optimization: Determine optimal buffer conditions (pH, salt concentration, additives) for maintaining protein stability and activity.

How does zebrafish Claudin-7-A compare to mammalian Claudin-7?

Comparative analysis of zebrafish Claudin-7-A and mammalian Claudin-7 reveals important evolutionary and functional relationships:

  • Sequence homology: Zebrafish Claudin-7-A shares significant sequence similarity with mammalian Claudin-7, particularly in transmembrane domains and extracellular loops that mediate tight junction formation.

  • Expression patterns: Both zebrafish and mammalian claudins show expression in epithelial tissues, particularly in structures like sensory placodes, branchial arches, and developing organs .

  • Evolutionary conservation: Claudin genes appear to have expanded along the chordate stem lineage from urochordates to gnathostomes, suggesting their importance in the evolution of vertebrate-specific structures .

  • Functional conservation: Both zebrafish and mammalian Claudin-7 participate in epithelial barrier formation and likely play roles beyond traditional tight junction functions.

  • Paralogs: While mammals typically have a single Claudin-7 gene, zebrafish may have paralogs due to genome duplication events during teleost evolution, potentially allowing for subfunctionalization or neofunctionalization of these genes .

  • Disease relevance: Both zebrafish and mammalian Claudin-7 have been implicated in disease processes, including cancer, making zebrafish a valuable model for studying human claudin-related pathologies .

How can zebrafish Claudin-7-A studies inform research on human epithelial diseases?

Zebrafish Claudin-7-A studies provide valuable insights into human epithelial diseases through several mechanisms:

  • Cancer research applications: Studies showing that Claudin-7 deficiency promotes stemness properties in colorectal cancer through Sox9-mediated Wnt/β-catenin signaling provide direct translational relevance to human cancer research .

  • Developmental disorder modeling: Zebrafish Claudin-7-A expression in sensory placodes suggests potential roles in human developmental disorders affecting sensory organs .

  • High-throughput screening: Zebrafish offer advantages for screening compounds that modulate Claudin-7 function, potentially identifying therapeutic candidates for human diseases.

  • Epithelial barrier dysfunction: Zebrafish models can reveal mechanisms by which Claudin-7 disruption affects epithelial barrier function, informing research on human conditions like inflammatory bowel disease.

  • Genetic compensation studies: Investigating compensatory mechanisms when Claudin-7-A is disrupted in zebrafish can reveal redundancy in tight junction protein networks relevant to human disease resilience or susceptibility.

  • Signaling pathway interactions: The identification of interactions between Claudin-7 and signaling pathways like Wnt/β-catenin provides targets for therapeutic intervention in human epithelial diseases .

  • Tissue regeneration insights: Zebrafish studies on Claudin-7-A's role in tissue regeneration may inform regenerative medicine approaches for human epithelial injuries.

What are the implications of Claudin-7-A research for understanding tight junction evolution?

Claudin-7-A research provides significant insights into tight junction evolution:

  • Evolutionary expansion: The claudin gene family appears to have expanded along the chordate stem lineage from urochordates to gnathostomes, parallel with the elaboration of vertebrate characters .

  • Functional diversification: The presence of multiple claudin genes in zebrafish (approximately 15) suggests functional diversification of tight junction proteins throughout vertebrate evolution .

  • Developmental roles: Expression of claudins in vertebrate primordia such as sensory placodes, branchial arches, and limb buds indicates their importance in the development of vertebrate-specific structures .

  • Beyond barrier function: Research suggests that tight junctions not only form barriers in mature epithelia but also participate in vertebrate morphogenesis, revealing evolutionary adaptation of these proteins for complex developmental functions .

  • Paralog specialization: The existence of claudin paralogs in zebrafish allows for investigation of how gene duplication events contribute to functional specialization in epithelial barriers across different tissues.

  • Conservation of disease mechanisms: The observation that Claudin-7 deficiency affects similar pathways across species (like Wnt/β-catenin signaling) suggests evolutionary conservation of disease-relevant mechanisms involving tight junction proteins .

  • Comparative genomic approaches: Studying the genomic organization and regulation of claudin genes across species provides insights into the evolutionary forces shaping epithelial barrier function in vertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.