Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167)

What is the molecular structure and function of CCDC167 in zebrafish?

CCDC167 (Coiled-coil domain-containing protein 167) in Danio rerio is a protein characterized by its coiled-coil structural motif, where alpha-helices are intertwined to form a supercoil structure. The zebrafish CCDC167 protein consists of 100 amino acids with the sequence: MTRTRTVKKEKISVASEIDRVEERKLQCKNSLERAEFRKRKQQLSDDDRLALEDEMTILNERVEKYEK DLQVLRGENRRNM­MLSVALLAISALFYYTFIY . The protein contains specific structural regions that enable protein-protein interactions, which are crucial for its biological functions.

While the precise function of CCDC167 in zebrafish remains under investigation, research on human CCDC167 suggests potential involvement in cell cycle regulation and proliferation pathways . Based on conserved domains and evolutionary relationships, zebrafish CCDC167 likely participates in similar cellular processes, potentially including cell division progression, mitosis initiation, and chromosome separation .

How can recombinant CCDC167 be effectively stored and handled for experimental use?

For optimal experimental outcomes with recombinant Danio rerio CCDC167:

Storage Conditions:

• Store at -20°C for regular storage periods

• For extended preservation, maintain at -80°C

• Utilize 50% glycerol in Tris-based buffer as storage medium

• Avoid repeated freeze-thaw cycles to maintain protein integrity

Handling Guidelines:

• Create working aliquots that can be stored at 4°C for up to one week

• Thaw frozen aliquots on ice to minimize protein degradation

• Centrifuge briefly after thawing to collect content at the bottom of the tube

• Validate protein activity after extended storage through functional assays

For experiments requiring higher protein concentrations, note that the recombinant protein is typically supplied at a quantity of 50 μg, though other quantities may be available upon request .

What experimental models are most suitable for studying CCDC167 function in zebrafish?

When investigating CCDC167 function in zebrafish, several experimental models offer distinct advantages:

Embryonic Models:

• Early embryonic stages (0-72 hpf) allow for easy observation of developmental effects

• Embryos permit high-throughput screening of morphological changes following CCDC167 manipulation

• Zebrafish embryo pools of different sizes (10-20 embryos per pool) provide optimal statistical power for gene expression studies

Cell-based Systems:

• Zebrafish cell lines can be utilized for in vitro studies of CCDC167 function

• Experimental approaches similar to those used with human MCF-7 cells can be adapted for zebrafish cell lines

• Short-term and long-term cell proliferation assays (MTT and colony formation) can assess CCDC167's impact on cellular growth

Knockdown/Knockout Models:

• Morpholino-based knockdown provides temporary reduction of CCDC167 expression

• CRISPR/Cas9-generated mutant lines offer permanent genetic models

• shRNA approaches (as used in human cell studies) can be adapted for zebrafish studies

The choice of model should align with specific research questions, with embryonic models being particularly suitable for developmental studies and cell-based systems for molecular pathway investigations.

How should gene expression analysis be designed when studying CCDC167 in zebrafish embryos?

When designing gene expression studies for CCDC167 in zebrafish embryos, consider these methodological recommendations:

Sample Size and Pooling Strategy:

• Utilize larger pool sizes (10-20 embryos per pool) and sample sizes (n=8-10) to minimize false positive differential gene expression

• Be aware that while larger pool and sample sizes reduce differential expression false positives, they may paradoxically increase false positives in Gene Set Enrichment Analysis (GSEA)

Expression Analysis Considerations:

Pathway Analysis Approaches:

• Over-Representation Analysis (ORA) shows fewer false positives with larger pool and sample sizes, making it preferable for well-powered studies

• GSEA produces more false positives in studies with larger pool sizes and in contrasts with zero differentially expressed genes (DEGs)

• Be particularly cautious with GSEA results showing enrichment of ribosomal gene sets in conditions with minimal differential expression, as these may be false positives

What approaches can be used to investigate CCDC167 co-expression networks in zebrafish?

To effectively investigate CCDC167 co-expression networks in zebrafish:

Network Analysis Methods:

• Leverage bioinformatics approaches similar to those used for human CCDC167 studies, including co-expression analysis from RNA-seq data

• Utilize zebrafish-specific databases to identify genes with expression patterns correlated with CCDC167

• Apply differential co-expression analysis to identify gene relationships that change between normal and experimental conditions

Integrated Analysis Workflow:

• Generate whole-transcriptome data from control and experimental conditions

• Identify genes whose expression correlates with CCDC167 across conditions

• Perform functional annotation of co-expressed genes using zebrafish-specific ontologies

• Validate key co-expression relationships through targeted gene expression studies

• Investigate protein-protein interactions among products of co-expressed genes

As demonstrated in human studies, CCDC167-co-expressed genes often associate with specific biological processes. In human breast cancer, CCDC167-co-expressed genes were involved in cell cycle-related molecular processes, suggesting that similar pathway enrichment might be observed in zebrafish studies .

How can knockdown/knockout approaches be optimized for studying CCDC167 function in zebrafish?

For effective genetic manipulation of CCDC167 in zebrafish:

Knockdown Strategies:

• Morpholino design should target splice junctions or translation start sites of ccdc167

• Use 1-4 ng of morpholino for embryo microinjection at the 1-2 cell stage

• Include appropriate controls: mismatch morpholinos and rescue experiments with co-injection of ccdc167 mRNA

• Validate knockdown efficiency through RT-PCR and Western blotting

CRISPR/Cas9 Knockout Approach:

• Design multiple guide RNAs targeting early exons of ccdc167

• Inject 100-300 pg of guide RNA and 300-500 pg of Cas9 mRNA

• Screen F0 mosaic embryos for phenotypes and mutation efficiency

• Establish stable F2 lines for comprehensive phenotypic analysis

Phenotypic Assessment:

• Based on human studies, examine proliferation, cell cycle progression, and apoptosis markers

• Assess developmental timing, morphology, and tissue-specific defects

• Perform transcriptomic analysis to identify affected pathways

• Consider chemical treatments (based on human cancer drug studies) to determine if they impact CCDC167-dependent phenotypes

Human studies demonstrated that knockdown of CCDC167 attenuated aggressive cancer growth and proliferation, suggesting zebrafish ccdc167 knockdown might yield observable phenotypes related to cell proliferation during development or in regeneration models .

What statistical considerations are critical when analyzing CCDC167 expression data in zebrafish studies?

When analyzing CCDC167 expression data in zebrafish:

Avoiding False Positives in Expression Studies:

• Be aware that pathway analysis methods respond differently to experimental design parameters

• Over-Representation Analysis (ORA) shows fewer false positives with larger pool and sample sizes

• Gene Set Enrichment Analysis (GSEA) shows more false positives under conditions with minimal differential expression

Statistical Analysis Guidelines:

Interpreting GSEA Results:

• Be particularly cautious when interpreting GSEA results in contrasts where there are no differentially expressed genes (DEGs)

• Ribosomal gene sets are especially prone to false-positive enrichment in GSEA due to their natural co-regulation

• Consistent direction of fold change (most genes up or most genes down) within a gene set can lead to false positive GSEA results even without significant individual gene changes

How can CCDC167 function in zebrafish be compared to its role in human disease models?

To effectively compare CCDC167 function across species:

Cross-Species Comparison Approach:

• Align zebrafish and human CCDC167 sequences to identify conserved domains and potential functional regions

• Compare expression patterns across tissues and developmental stages

• Assess conservation of co-expression networks and pathway associations

• Validate functional conservation through rescue experiments (human CCDC167 in zebrafish knockouts)

Translational Considerations:

Human studies have established several key findings about CCDC167 that may guide zebrafish research:

• CCDC167 is upregulated in various human tumor types, particularly breast cancer

• High CCDC167 expression correlates with poor prognosis in breast cancer patients

• CCDC167 knockdown reduces cell proliferation and colony formation in human cancer cells

• Treatment with chemotherapeutic agents (fluorouracil, carboplatin, paclitaxel, doxorubicin) decreases CCDC167 expression in human cancer cells

These findings suggest potential experimental designs in zebrafish, such as:

• Examining ccdc167 expression in zebrafish cancer models

• Assessing the impact of ccdc167 manipulation on cell proliferation during development or regeneration

• Testing whether drugs that target human CCDC167 have similar effects in zebrafish models

What experimental controls are essential when studying the effects of CCDC167 manipulation in zebrafish?

Robust experimental design requires appropriate controls:

Essential Control Strategies:

Addressing GSEA False Positives:

• Include bidirectional analysis (checking both up and down-regulated pathways)

• Confirm directional consistency across replicates

• Be particularly cautious of ribosomal gene set enrichment when minimal differential expression is observed

• Validate key findings with alternative analysis methods (like ORA)

Phenotypic Analysis:

• Include wild-type siblings from the same clutch as knockdown/knockout embryos

• Perform blinded phenotypic scoring to reduce observer bias

• Include quantitative metrics alongside qualitative assessments

• Use appropriate rescue approaches to confirm phenotype specificity

How might CCDC167 function in zebrafish development and disease models?

Based on current knowledge of CCDC167 biology:

Developmental Roles:

• Given human CCDC167's association with cell cycle processes, zebrafish ccdc167 likely functions in proliferative aspects of development

• Expression patterns may correlate with highly proliferative developmental periods and tissues

• Potential involvement in organogenesis, particularly in tissues requiring rapid proliferation

• Possible role in regenerative processes, which are prominent in zebrafish models

Disease Modeling Applications:

• Zebrafish cancer models could reveal ccdc167's role in tumor initiation and progression

• Based on human studies, ccdc167 manipulation might affect proliferation in regeneration and wound healing models

• Potential utility in drug screening platforms targeting ccdc167 or its pathways

• Developmental timing defects may emerge from ccdc167 dysfunction if cell cycle regulation is impaired

Human studies identified cell cycle, immune response, and ubiquitination-related pathways as being associated with CCDC167 co-expressed genes . These pathways are highly conserved and likely relevant to zebrafish ccdc167 function as well.

What are the challenges and limitations in interpreting CCDC167 functional studies in zebrafish?

Researchers should consider these important limitations:

Methodological Challenges:

• Gene duplication events in teleost fish may have created paralogs with divergent functions

• Developmental timing differences between zebrafish and mammals complicate direct translation of findings

• Background strain differences can influence phenotypic outcomes of genetic manipulations

• Technical variability in microinjection and gene expression can impact experimental reproducibility

Analytical Considerations:

• False positives in GSEA, particularly for ribosomal gene sets, can lead to erroneous pathway annotations

• The signal-to-noise ratio in gene expression studies is particularly important—studies with minimal differential expression are especially prone to GSEA false positives

• Pathway analysis results may be susceptible to both type I errors (false positives) and type II errors (false negatives) depending on experimental design

• Coordinated gene expression patterns can lead to statistically significant but biologically irrelevant pathway enrichment

Translational Limitations:

• Differences in tissue architecture and physiology between zebrafish and humans

• Limited conservation of certain signaling pathways and regulatory mechanisms

• Zebrafish may lack certain cell types or specialized tissues present in mammals

• Drug metabolism and pharmacokinetics differ between zebrafish and humans

What emerging technologies could enhance CCDC167 research in zebrafish models?

Several cutting-edge approaches show promise for advancing zebrafish CCDC167 research:

Advanced Genetic Tools:

• Conditional knockout systems using Cre-lox or inducible promoters

• Base editing and prime editing for precise genetic modifications

• Optogenetic and chemogenetic tools for temporal control of ccdc167 activity

• Single-cell RNA sequencing to identify cell-specific roles of ccdc167

Imaging Innovations:

• Live imaging of fluorescently tagged Ccdc167 protein to track subcellular localization

• Light sheet microscopy for whole-organism imaging with minimal phototoxicity

• Super-resolution microscopy to visualize protein-protein interactions

• Correlative light and electron microscopy for ultrastructural contexts

Computational Approaches:

• Machine learning algorithms for phenotypic classification

• Network analysis tools for integrating multi-omics data

• Improved GSEA implementations that address false positive issues in low-signal conditions

• Cross-species pathway analysis tools to facilitate translational interpretations

Combining these technologies with the inherent advantages of zebrafish models (transparency, high fecundity, external development) will enable more comprehensive understanding of CCDC167 biology.

How can findings from zebrafish CCDC167 studies be effectively translated to human health applications?

Translational strategies for zebrafish CCDC167 research:

Bridging Model Systems:

• Validate key zebrafish findings in mammalian cell cultures and mouse models

• Perform comparative studies of CCDC167 pathway conservation across species

• Use humanized zebrafish models expressing human CCDC167 variants

• Develop zebrafish assays specifically designed to complement clinical observations

Drug Discovery Applications:

• Screen compound libraries for modulators of ccdc167 expression or function

• Test chemotherapeutic agents identified in human studies (fluorouracil, carboplatin, paclitaxel, doxorubicin) in zebrafish models

• Develop targeted approaches based on ccdc167 co-expression networks

• Validate hits from zebrafish screens in human cell and tissue models

Clinical Relevance:
Based on human studies, CCDC167 has been identified as a potential therapeutic target in breast cancer, with knockdown attenuating cancer cell growth and proliferation . Zebrafish models could help elucidate:

• Fundamental mechanisms of CCDC167 function relevant to human disease

• Off-target effects of CCDC167-targeting therapeutics

• Developmental impacts of CCDC167 modulation

• Combination therapy approaches involving CCDC167 pathway intervention