Gene name: cystm1 (also annotated as zgc:165573 in zebrafish) .
Protein length: Partial sequences (specific regions) are commonly produced in recombinant systems .
Domains: Contains a CYSTM (Cysteine-rich transmembrane) domain, a conserved feature across species .
Immunogen sequence: Key residues include QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG .
Post-translational modifications: Predicted membrane localization due to hydrophobic transmembrane regions .
Recombinant cystm1 is produced using diverse host systems:
Myogenesis: Human ortholog CYSTM1 represses inhibitors ID2 and ID3 during skeletal muscle development .
Oxidative stress response: Interacts with thioredoxin-related transmembrane protein 1 (TMX1) and cytochrome complexes, suggesting redox regulation .
Disease associations: Rat Cystm1 is linked to experimental liver cirrhosis, hinting at metabolic roles .
Antibody development: Rabbit polyclonal antibodies target zebrafish cystm1 for immunoassays .
Transcriptome studies: Featured in zebrafish embryonic single-cell RNA-seq datasets, highlighting expression in pronephros and muscle lineages .
Plant immunity models: Arabidopsis CYSTM homologs (e.g., PCM4) regulate pathogen resistance, suggesting evolutionary conservation of cysteine-rich domain functions .
Yield optimization: Stacked promoter systems (e.g., pUDEPB) enhance recombinant protein production up to 13.8-fold in heterologous systems .
Localization conflicts: Discrepancies exist between predicted plasma membrane anchoring (via CYSTM domains) and observed cytoplasmic localization in some assays .
KEGG: dre:100073329
UniGene: Dr.85599
The CYSTM (Cysteine-rich and transmembrane domain-containing) proteins constitute a family of proteins characterized by a distinctive cysteine-rich domain and a putative transmembrane region. In zebrafish (Danio rerio), cystm1 is a member of this protein family with structural similarities to its human ortholog. The CYSTM protein family is also sometimes referred to as CYSPD proteins in scientific literature . These proteins are evolutionarily conserved and have been identified across various species including humans, zebrafish, and yeast, suggesting important biological functions. Recent research has highlighted the significance of human CYSTM1 as an early marker for Huntington's disease, indicating potential roles in neurodegenerative processes .
Zebrafish represents an ideal model organism for studying cystm1 and other proteins due to its numerous experimental advantages. Unlike mammalian models, zebrafish embryos develop externally and are transparent, allowing for real-time visualization of developmental processes. The zebrafish genome has been fully sequenced and exhibits remarkable homology with human genes, making it valuable for translational research . Specifically for cystm1 research, zebrafish provides an accessible system for studying protein function in a vertebrate context that recapitulates many aspects of human development and physiology. The genetic mechanisms and signaling pathways, particularly those involving redox signaling and lipid metabolism, are strikingly similar between zebrafish and humans . Additionally, zebrafish are amenable to genetic manipulation through techniques like forward genetic screens and whole-exome sequencing, facilitating the identification and characterization of genes involved in developmental processes and disease .
Several methodological approaches can be employed to detect post-translational modifications of cystm1, particularly focusing on palmitoylation which appears significant for CYSTM proteins. The acyl-biotin exchange (ABE) assay represents a powerful technique for identifying palmitoylated proteins. In this method, free thiols from cysteine residues are initially blocked using N-ethylmaleimide, followed by hydroxylamine treatment to release thioester-bound palmitates. The newly exposed thiols are then reacted with a biotinylating agent, allowing for affinity purification and subsequent analysis .
An alternative approach involves metabolic labeling with azido-palmitate, which can be biotinylated through click-chemistry reactions. This technique enables the selective pulldown and identification of palmitoylated proteins via Western blot analysis . For comprehensive structural characterization of cysteine modifications, mass spectrometry-based approaches are highly effective. Techniques like electrospray ionization mass spectrometry (ESI-MS) can be used to analyze selective cysteine modifications, providing insights into protein structural properties . Additionally, top-down Fourier transform ion cyclotron resonance (FTICR) mass spectrometry has been successfully employed to identify reactive cysteine residues in cysteine-rich proteins .
Palmitoylation of CYSTM proteins, including cystm1, appears to be critical for their localization and function, though the precise relationship remains under investigation. Research in yeast CYSTM proteins demonstrates that they undergo palmitoylation, which influences their subcellular distribution and interactions with other proteins . This post-translational modification likely affects the membrane association properties of cystm1, potentially impacting its function in signaling pathways or protein complexes.
The palmitoylation process involves the addition of palmitate to cysteine residues through thioester bonds, which can be dynamically regulated. For CYSTM proteins, cysteines located near transmembrane domains or within cysteine-rich motifs can serve as palmitoylation sites . Experimental evidence from yeast CYSTM proteins shows that mutation of these cysteine residues abolishes palmitoylation and alters protein localization. The functional consequences of palmitoylation may include changes in protein stability, trafficking, and intermolecular interactions .
To experimentally determine the relationship between palmitoylation and function, researchers can generate non-palmitoylable variants by mutating cysteine residues (as demonstrated with a GFP-Cpp1 5xΔCys construct lacking all cysteines) and compare their properties with wild-type proteins . Additional approaches may include pharmacological inhibition of palmitoyl transferases or targeted analysis of palmitoylation dynamics in response to physiological stimuli.
Zebrafish cystm1 and human CYSTM1 share significant structural and functional similarities, though comprehensive comparative studies are still emerging. Both proteins contain characteristic cysteine-rich domains that are evolutionarily conserved. The cysteine residues in these proteins are critical for their structural integrity and potential for post-translational modifications like palmitoylation . The transmembrane prediction for CYSTM proteins remains somewhat ambiguous, with various algorithms yielding inconsistent results regarding the presence of transmembrane domains .
Functionally, both zebrafish and human CYSTM proteins appear to have roles in cellular stress responses and potentially in disease processes. Human CYSTM1 has been identified as an early marker for Huntington's disease, suggesting involvement in neurodegenerative pathways . While direct evidence for zebrafish cystm1 in disease models is still developing, the conservation between species suggests similar functional roles.
The expression patterns and developmental timing of cystm1 in zebrafish compared to humans could provide additional insights into conserved and divergent functions. Research utilizing zebrafish models to study cystm1 function may contribute valuable translational information applicable to human CYSTM1 biology and associated pathologies.
Several genetic manipulation approaches can be effectively employed to study cystm1 function in zebrafish:
Forward Genetic Screens: This traditional approach involves random mutagenesis followed by phenotypic screening to identify mutations affecting specific biological processes. While powerful for discovering novel gene functions, this method requires significant resources for mapping and isolating mutations .
Whole Exome Sequencing (WES): This technique represents a rapid and cost-effective approach for identifying mutations following forward genetic screens. WES focuses on sequencing only the protein-coding regions of the genome, making it more efficient than whole-genome sequencing. The methodology involves:
CRISPR-Cas9 Gene Editing: This approach allows for precise targeting of the cystm1 gene to create knockout or knockin models. CRISPR-Cas9 can be used to:
Generate complete gene knockouts to study loss-of-function effects
Introduce specific mutations to model disease variants
Create reporter lines by inserting fluorescent tags
Morpholino-based Knockdown: While less specific than CRISPR-Cas9, antisense morpholino oligonucleotides can be used for temporary knockdown of cystm1 during early development.
Transgenic Overexpression: Creating transgenic lines that overexpress wild-type or mutant versions of cystm1 can help elucidate gain-of-function effects.
The choice of genetic manipulation technique depends on research objectives, timeframe, and available resources. For comprehensive functional analysis, combining multiple approaches may provide the most robust results.
Mass spectrometry (MS) offers powerful approaches for structural analysis of cysteine-rich proteins like cystm1, but requires careful optimization. A comprehensive data analysis pipeline for MS-based structural analysis should address charge-state deconvolution, statistical scoring, and mass assignment for native MS, bottom-up, and top-down analyses . For cysteine-rich proteins specifically, several methodological considerations are critical:
Selective Cysteine Modification Coupled with ESI-MS: This approach involves using cysteine-reactive reagents such as p-benzoquinone (Bq), N-ethylmaleimide (NEM), or iodoacetamide (IAM) to selectively modify cysteine residues, followed by electrospray ionization mass spectrometry (ESI-MS) analysis. The modification profiles can reveal important structural information about the protein's folding and accessibility of cysteine residues .
pH-Dependent Analysis: Comparing modification patterns under denaturing conditions (low pH) versus native conditions (neutral pH) can provide insights into protein structure. Under denaturing conditions, cysteine modifications typically follow stochastic distributions, while at neutral pH, larger modifiers like Bq and NEM may show cooperative patterns if the protein adopts a compact structure .
Top-Down FTICR MS: Fourier transform ion cyclotron resonance mass spectrometry allows for the analysis of intact proteins without prior digestion. This technique has been successfully applied to identify reactive cysteine residues in cysteine-rich proteins and is particularly valuable for preserving post-translational modifications .
Metal-Binding Analysis: For cysteine-rich proteins that potentially bind metals, MS can be combined with metal-chelation studies to identify metal-binding cysteines. This approach has been used to identify zinc-binding cysteines across hundreds of proteins in the human proteome .
Promiscuous Cysteine-Reactive Probes: These probes can globally identify potential metal-binding cysteines and provide complementary information to computational and structural methods .
Optimization of these approaches requires careful consideration of sample preparation, instrument parameters, and data analysis strategies tailored to the specific characteristics of cystm1.
Several complementary techniques can be employed to detect and characterize protein-protein interactions involving cystm1:
Protein-Fragment Complementation Analysis: This approach has been successfully used to demonstrate direct interactions between CYSTM proteins and other cellular components. For example, an interaction between the yeast CYSTM protein Cpp3 and the palmitoyl acyltransferase Akr1 was identified using this technique .
Co-Immunoprecipitation (Co-IP): This classical method involves using antibodies against cystm1 or its tagged version to pull down protein complexes, followed by mass spectrometry or Western blot analysis to identify interacting partners.
Yeast Two-Hybrid (Y2H) Screening: While this technique may have limitations for transmembrane proteins, modified versions such as split-ubiquitin Y2H can be effective for identifying interactions involving membrane-associated proteins like cystm1.
Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in living cells by fusing complementary fragments of a fluorescent protein to potential interacting partners.
Proximity-Based Labeling: Methods like BioID or APEX2 involve fusing a biotin ligase or peroxidase to cystm1, which then biotinylates or labels proteins in close proximity, allowing for their identification via streptavidin pulldown and mass spectrometry.
Crosslinking Mass Spectrometry: Chemical crosslinking combined with MS analysis can capture transient interactions and provide structural information about protein complexes involving cystm1.
When investigating interactions involving palmitoylated forms of cystm1, researchers should consider how this post-translational modification affects interaction profiles. Experimental approaches that preserve the native membrane environment, such as membrane-based pull-downs or in-cell crosslinking, may be particularly valuable for studying cystm1 interactions in their physiological context.
Zebrafish cystm1 may serve important functions in disease modeling, particularly for conditions involving ciliary dysfunction and neurodegenerative processes. The expression of human CYSTM1 has been identified as an early marker for Huntington's disease, suggesting a potential role for CYSTM proteins in neurodegenerative pathways . This connection warrants investigation of zebrafish cystm1 in models of neurodegeneration.
Additionally, zebrafish have proven valuable for modeling kidney cyst formation, which is often associated with ciliary defects . Forward genetic screens in zebrafish have identified mutations causing kidney cysts, and whole exome sequencing approaches have facilitated the isolation of these mutations. Given that defects in primary cilia have been causally linked to cyst formation in both humans and zebrafish, investigating the potential role of cystm1 in ciliary function and kidney development could yield important insights .
The zebrafish model offers significant advantages for disease modeling, including:
Transparent embryos allowing real-time visualization of development
Rapid development and high fecundity
Genetic tractability for creating disease models
Leveraging these advantages to study cystm1 function in disease contexts could provide valuable translational insights applicable to human pathologies.
Recombinant Danio rerio cystm1 protein can serve as a valuable tool in drug screening applications, particularly for compounds targeting palmitoylation or protein-protein interactions involving CYSTM family proteins. The availability of purified recombinant protein enables the development of in vitro assays to screen for molecules that modulate cystm1 function or post-translational modifications.
For drug screening applications, researchers might consider the following approaches:
Palmitoylation Inhibitor Screening: Given the importance of palmitoylation for CYSTM proteins , assays could be developed to identify compounds that specifically inhibit or promote cystm1 palmitoylation. These assays might utilize fluorescently labeled recombinant cystm1 and measure changes in membrane association or protein mobility following compound treatment.
Protein-Protein Interaction Modulators: Using techniques like fluorescence polarization or surface plasmon resonance with recombinant cystm1, researchers can screen for compounds that disrupt or enhance interactions with known binding partners.
Zebrafish-Based Phenotypic Screens: Whole-organism screens can be performed using transgenic zebrafish expressing fluorescently tagged cystm1 to identify compounds that affect its localization, expression, or associated phenotypes.
The zebrafish model has already demonstrated utility in drug screening, as evidenced by studies of cholesterol-lowering drugs. For example, ezetimibe has been shown to reduce cholesterol levels in high-cholesterol diet-fed zebrafish larvae, recapitulating its effects in humans . Similar approaches could be applied to screen for compounds affecting cystm1-related pathways or phenotypes.
Analyzing the redox properties of cysteine residues in cystm1 requires specialized techniques that can distinguish between different oxidation states and modifications. Several methodological approaches can be effectively employed:
Cysteine Modification Profiling: This approach involves selective modification of cysteine residues with reagents like p-benzoquinone (Bq), N-ethylmaleimide (NEM), or iodoacetamide (IAM), followed by ESI-MS analysis. The reaction profiles under different pH conditions can reveal important information about cysteine accessibility and reactivity .
Redox Proteomics Approaches: These methods involve differential labeling of reduced and oxidized cysteines, typically using isotope-coded affinity tags or other cysteine-reactive probes. For example, reduced cysteines can be alkylated with one reagent, followed by reduction of oxidized cysteines and labeling with a different reagent.
Selective Reaction Monitoring (SRM) Mass Spectrometry: This targeted MS approach allows for quantitative analysis of specific cysteine-containing peptides in different redox states, providing precise information about the oxidation status of individual cysteines.
Metal-Binding Analysis: Since cysteine residues often coordinate metal ions, techniques to identify metal-binding cysteines can provide insights into their redox properties. A proteomic approach using promiscuous cysteine-reactive probes has been applied to globally identify putative zinc-binding cysteines across approximately 900 cysteines in the human proteome .
Functional Assays Coupled with Site-Directed Mutagenesis: By systematically mutating cysteine residues and assessing the impact on protein function under different redox conditions, researchers can identify redox-sensitive cysteines critical for cystm1 function.
The zebrafish model offers additional advantages for studying redox mechanisms, as redox signaling pathways and antioxidant enzymes in zebrafish are strikingly similar to those in humans . This similarity enhances the translational relevance of findings from zebrafish cystm1 studies to human health and disease.