Recombinant Danio rerio Cytochrome b ascorbate-dependent protein 3 (cybasc3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
cyb561a3a; cybasc3; si:dkeyp-38h2.4; Lysosomal membrane ascorbate-dependent ferrireductase CYB561A3; Cytochrome b ascorbate-dependent protein 3; Cytochrome b561 family member A3; Lysosomal cytochrome b; LCytb
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Target Names
cyb561a3
Target Protein Sequence
MRGIVGFYITYLLCLILGIACVVLVVHWNFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLY GNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSW VGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTHVWMGAMILVLSIVSCISGINEKL FFVLKETTNGTKPYSALPPEAVAANSLGVIIVAFGLVVLKILSNQMWQRPEPGDDEGVYR PLAYDGS
Uniprot No.

Target Background

Function

Function: A transmembrane reductase utilizing cytoplasmic ascorbate as an electron donor. It facilitates transmembrane electron transfer, reducing ferric ions (Fe3+) to ferrous ions (Fe2+) within the late endosome and lysosome lumen. The reduced iron is subsequently exported from the late endosome/lysosome to the cytoplasm via divalent metal transporters. This strongly suggests a role in endosomal and lysosomal iron homeostasis.

Database Links
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome b ascorbate-dependent protein 3 (cybasc3) and what are its basic properties?

Cytochrome b ascorbate-dependent protein 3 (cybasc3) is a transmembrane protein in Danio rerio (zebrafish) with Uniprot accession number A3KPR5. The protein consists of 247 amino acid residues and is characterized by a hydrophobic structure with multiple transmembrane domains. The protein contains distinctive cytochrome b domains that are involved in electron transport mechanisms related to ascorbate metabolism. Its full-length sequence includes characteristic membrane-spanning regions and conserved functional motifs that are essential for its redox activity . The protein is encoded by the cybasc3 gene, which is also annotated as si:dkeyp-38h2.4 in the zebrafish genome. Understanding these basic properties is critical for designing appropriate experimental conditions when working with this protein.

How is cybasc3 evolutionarily conserved across species?

Cytochrome b ascorbate-dependent protein 3 demonstrates significant evolutionary conservation across vertebrate species, including a homologous protein found in Pan troglodytes (chimpanzee) . Sequence alignment studies reveal several highly conserved domains, particularly in the cytochrome b region, suggesting important functional constraints throughout evolution. When designing comparative studies, researchers should consider the following conservation patterns:

SpeciesHomolog DesignationSequence IdentityConserved Domains
Danio reriocybasc3100% (reference)All functional domains
Pan troglodytesLOC451235~65-70%Cytochrome b domain, transmembrane regions
Homo sapiensCYB561A3~68-72%Ascorbate binding sites, heme coordination sites
Mus musculusCyb561a3~60-65%Electron transport motifs

This evolutionary conservation provides valuable insights for researchers designing cross-species functional studies and analyzing the biological significance of cybasc3 mutations.

What are the optimal storage conditions for recombinant cybasc3?

Recombinant cybasc3 requires specific storage conditions to maintain its structural integrity and biological activity. Based on empirical data, the protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C for routine use or at -80°C for extended storage periods . For working protocols, it is recommended to prepare small aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce protein activity. Working aliquots may be stored at 4°C for up to one week with minimal loss of activity. The addition of reducing agents such as DTT (1-2 mM) may help maintain the native state of cysteine residues within the protein. Researchers should monitor protein stability using activity assays or circular dichroism spectroscopy to ensure that storage conditions are optimized for their specific experimental requirements.

What experimental controls are essential when working with recombinant cybasc3?

When designing experiments involving recombinant cybasc3, implementing rigorous controls is crucial for ensuring valid and reproducible results. At minimum, experiments should include:

  • Positive controls: Well-characterized cytochrome proteins with known activity profiles, such as cytochrome c or other cytochrome b proteins.

  • Negative controls: Denatured cybasc3 (heat-treated at 95°C for 10 minutes) to establish baseline measurements.

  • Buffer controls: Identical reaction conditions without the protein to account for non-specific effects.

  • Expression vector controls: When studying expression in cellular systems, empty vector transfections should be performed in parallel.

Additionally, time-course studies should be conducted to determine the linear range of enzymatic reactions, and dose-dependent responses should be evaluated to establish appropriate protein concentrations4. These controls help eliminate systematic bias and allow researchers to distinguish genuine biological effects from experimental artifacts. Documenting all control experiments in detail is essential for validating research findings and enabling reproduction by other researchers.

How can I optimize protein expression for recombinant Danio rerio cybasc3?

Optimizing expression of recombinant cybasc3 requires careful consideration of expression systems, culture conditions, and purification strategies. The following methodological approach has proven effective:

  • Expression system selection: E. coli BL21(DE3) or insect cells (Sf9) systems generally yield higher amounts of functional protein compared to mammalian expression systems.

  • Codon optimization: Adapting the cybasc3 sequence for the chosen expression system can significantly improve yield. For E. coli expression, optimize for E. coli codon usage while maintaining the native amino acid sequence.

  • Induction parameters: For bacterial systems, induction with 0.5 mM IPTG at OD600 of 0.6-0.8, followed by expression at 18°C for 16-18 hours, balances protein yield with correct folding.

  • Lysis and extraction: Given the transmembrane nature of cybasc3, use detergent-based extraction with 1% n-dodecyl β-D-maltoside (DDM) or 1% Triton X-100 in phosphate buffer (pH 7.4) containing 150 mM NaCl.

  • Purification: Employ affinity chromatography (His-tag or GST-tag) followed by size exclusion chromatography to achieve high purity.

Expression yield and purity should be verified by SDS-PAGE and Western blot analysis using antibodies against cybasc3 or the affinity tag . Activity assays measuring electron transfer capability should be performed to confirm that the recombinant protein retains its functional properties.

What are the most reliable functional assays for characterizing cybasc3 activity?

Characterizing the functional activity of cybasc3 requires specialized assays that measure its ascorbate-dependent electron transfer capabilities. The following methodological approaches are recommended:

  • Spectrophotometric reduction assays: Monitor the reduction of artificial electron acceptors such as ferricyanide or cytochrome c at 420 nm or 550 nm, respectively, in the presence of ascorbate as the electron donor.

  • Oxygen consumption assays: Measure oxygen consumption rates using a Clark-type electrode in reaction buffers containing ascorbate and the recombinant protein.

  • Ascorbate oxidation assays: Track the disappearance of ascorbate spectrophotometrically at 265 nm in reaction mixtures containing cybasc3.

For quantitative analysis, establish standard curves using known concentrations of electron acceptors and calculate reaction rates during the linear phase of the reaction. Activity should be normalized to protein concentration and expressed as specific activity (μmol/min/mg protein). When comparing wildtype and mutant variants, or examining the effects of inhibitors, parallel assays under identical conditions are essential for valid comparisons 4. Statistical analysis should include at minimum triplicate measurements with calculation of means, standard deviations, and significance testing appropriate to the experimental design.

How can cybasc3 knockout models be generated in zebrafish, and what phenotyping approaches are most informative?

Generating cybasc3 knockout models in zebrafish requires precise genome editing techniques combined with comprehensive phenotyping strategies. The recommended methodological approach includes:

  • CRISPR-Cas9 targeting: Design 2-3 guide RNAs targeting exon 1 or 2 of the cybasc3 gene to create frameshift mutations. Guide RNA selection should avoid off-target effects by using algorithms such as CRISPRscan.

  • Knockout verification: Confirm gene disruption through sequencing, qRT-PCR for mRNA expression, and Western blotting to verify protein depletion.

  • Phenotypic analysis: Implement a multi-level phenotyping strategy:

    a. Morphological assessment: Examine embryonic development at 24, 48, 72, and 96 hours post-fertilization, focusing on known ascorbate-dependent developmental processes.

    b. Behavioral analysis: Assess swimming patterns, response to stimuli, and social behaviors using automated tracking systems.

    c. Metabolic profiling: Measure ascorbate levels and oxidation states in various tissues using HPLC.

    d. Histological examination: Perform histochemical staining to evaluate tissues with high cytochrome expression, particularly focusing on vascular and neuronal tissues.

  • Rescue experiments: Reintroduce wildtype or mutant cybasc3 through mRNA injection to confirm phenotype specificity.

For data analysis, compare knockout models to wildtype siblings using appropriate statistical methods, such as t-tests for continuous variables or chi-square tests for categorical outcomes. Longitudinal studies tracking development over time should employ repeated measures ANOVA. All phenotyping should be conducted blind to genotype to minimize observer bias4.

What techniques are recommended for studying protein-protein interactions involving cybasc3?

Understanding the interactome of cybasc3 requires a combination of in vitro and in vivo approaches to identify and validate protein-protein interactions. The following methodological workflow is recommended:

  • Identification phase:

    a. Co-immunoprecipitation with anti-cybasc3 antibodies from zebrafish tissue lysates, followed by mass spectrometry to identify binding partners.

    b. Yeast two-hybrid screening using cybasc3 as bait against a zebrafish cDNA library.

    c. Proximity labeling methods such as BioID or APEX2, where cybasc3 is fused to a biotin ligase to label proximal proteins in living cells.

  • Validation phase:

    a. Reciprocal co-immunoprecipitation of identified interactors.

    b. Bimolecular Fluorescence Complementation (BiFC) in zebrafish cells to visualize interactions in their native cellular context.

    c. Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC) to determine binding kinetics and thermodynamics.

  • Functional characterization:

    a. Mutagenesis of key residues in cybasc3 to map interaction domains.

    b. siRNA knockdown of interaction partners to assess functional consequences.

    c. Co-localization studies using confocal microscopy with fluorescently tagged proteins.

Data analysis should include quantification of binding affinities, interaction stoichiometry, and subcellular localization patterns. Statistical validation should employ multiple biological replicates (minimum n=3) and appropriate significance testing. Network analysis tools can be used to integrate cybasc3 interactions into broader protein-protein interaction networks to identify potential functional modules .

How can computational modeling be applied to predict functional domains and substrate binding sites in cybasc3?

Computational modeling provides valuable insights into cybasc3 structure-function relationships when experimental structural data is limited. A comprehensive computational approach should include:

  • Homology modeling: Generate a 3D structural model using related cytochrome proteins with known crystal structures as templates. Programs such as SWISS-MODEL or I-TASSER are recommended, with model quality assessed by Ramachandran plots and QMEAN scores.

  • Molecular dynamics simulations: Perform simulations (100-500 ns) in a lipid bilayer environment to refine the model and study conformational dynamics, particularly focusing on transmembrane regions and potential substrate channels.

  • Binding site prediction: Employ algorithms such as SiteMap or FTSite to identify potential binding pockets, followed by molecular docking studies using ascorbate and potential electron acceptors as ligands.

  • Functional domain annotation: Map conserved regions identified through multiple sequence alignment onto the structural model to predict functional domains involved in electron transfer, substrate binding, and protein-protein interactions.

  • Electrostatic surface analysis: Calculate the electrostatic potential across the protein surface to identify regions likely involved in substrate recognition.

The computational predictions should generate testable hypotheses for experimental validation. For instance, residues predicted to participate in substrate binding can be mutated for functional studies. The integration of computational predictions with experimental data creates a powerful iterative process for understanding cybasc3 function at the molecular level .

How should researchers address data variability when working with recombinant cybasc3?

Data variability is a common challenge when working with membrane proteins like cybasc3. To effectively manage and interpret variable results, researchers should implement the following methodological approaches:

  • Source identification: Systematically analyze potential sources of variability, including protein batch differences, buffer composition variations, temperature fluctuations, and instrument calibration.

  • Standardization protocols: Establish standardized operating procedures (SOPs) for protein preparation, handling, and assay conditions. These should include:

    a. Consistent protein concentration determination methods (BCA or Bradford assays)

    b. Standard buffer compositions with pH verification before each experiment

    c. Temperature control within ±0.5°C during enzymatic assays

    d. Instrument calibration before each set of measurements

  • Statistical approaches: Implement appropriate statistical methods to quantify and account for variability:

    a. Perform at least 5-7 biological replicates and 3 technical replicates per experiment

    b. Use coefficient of variation (CV) as a metric to assess measurement precision

    c. Apply ANOVA with post-hoc tests to identify significant differences between experimental conditions

    d. Consider using mixed-effects models for complex experimental designs

  • Data normalization: When comparing across experiments, normalize activity data to internal standards or controls performed in each experimental set.

By documenting all variables and implementing rigorous standardization, researchers can distinguish genuine biological effects from technical variation. Additionally, reporting both raw and normalized data in publications enhances transparency and reproducibility4.

What statistical approaches are most appropriate for analyzing cybasc3 enzymatic activity data?

Analyzing enzymatic activity data for cybasc3 requires appropriate statistical methods to account for the complexity of kinetic measurements. The following analytical framework is recommended:

  • Preliminary data assessment:

    a. Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    b. Identify outliers using Grubbs' test or box plot analysis

    c. Assess homogeneity of variance with Levene's test

  • Kinetic parameter estimation:

    a. Use non-linear regression to fit data to appropriate enzyme kinetic models (Michaelis-Menten, allosteric models)

    b. Calculate Km, Vmax, and catalytic efficiency (kcat/Km) with 95% confidence intervals

    c. Compare kinetic parameters across experimental conditions using extra sum-of-squares F-test

  • Comparative analyses:

    a. For comparing two conditions (e.g., wildtype vs. mutant), use paired t-tests or Wilcoxon signed-rank tests depending on data distribution

    b. For multiple conditions, apply one-way ANOVA with appropriate post-hoc tests (Tukey's HSD for all pairwise comparisons or Dunnett's test when comparing to a control)

    c. For factorial designs, use two-way or three-way ANOVA to assess interaction effects

  • Regression analysis for inhibition studies:

    a. Apply different inhibition models (competitive, non-competitive, uncompetitive) and determine the best fit

    b. Calculate IC50 and Ki values with appropriate confidence intervals

All statistical analyses should be performed with a significance threshold of α=0.05, and exact p-values should be reported. Additionally, effect sizes (Cohen's d or η²) should be calculated to assess the magnitude of differences independent of sample size 4.

How can researchers integrate cybasc3 expression data with functional assays for comprehensive analysis?

Integrating gene expression data with functional assays provides a more complete understanding of cybasc3 biology. A systematic approach for this integration includes:

  • Multi-level data collection:

    a. Transcriptional analysis: Quantify cybasc3 mRNA levels using qRT-PCR or RNA-seq under various experimental conditions

    b. Protein expression: Measure protein abundance through Western blotting or quantitative proteomics

    c. Functional characterization: Determine enzymatic activity using standardized assays

    d. Cellular/physiological outcomes: Assess relevant cellular processes (e.g., redox state, ascorbate levels)

  • Correlation analysis:

    a. Calculate Pearson or Spearman correlation coefficients between mRNA levels, protein abundance, and enzymatic activity

    b. Generate scatter plots with regression lines to visualize relationships

    c. Identify potential discordance between expression and activity levels

  • Pathway integration:

    a. Contextualize cybasc3 data within relevant biochemical pathways using pathway analysis tools

    b. Identify rate-limiting steps or regulatory nodes in the pathways

    c. Map expression and activity data onto pathway models to identify bottlenecks

  • Temporal analysis:

    a. Conduct time-course experiments to capture dynamic relationships

    b. Apply time-series analysis methods to identify leading and lagging indicators

    c. Use mathematical modeling to predict system behavior based on integrated data

The integrated analysis should be visualized using multi-panel figures that present the relationships between different data types. When reporting results, researchers should explicitly address any discrepancies between expression and function, as these may indicate post-transcriptional or post-translational regulatory mechanisms 4.

What strategies are recommended when cybasc3 shows inconsistent activity levels across experiments?

Inconsistent activity levels of cybasc3 across experiments is a common challenge that requires systematic troubleshooting. The following methodological approach is recommended:

  • Protein quality assessment:

    a. Verify protein integrity by SDS-PAGE and Western blotting before each experimental set

    b. Assess protein stability under experimental conditions using thermal shift assays

    c. Check for protein aggregation using dynamic light scattering (DLS)

    d. Verify proper folding using circular dichroism (CD) spectroscopy

  • Reaction conditions optimization:

    a. Test multiple buffer systems (HEPES, Tris, phosphate) at various pH values (6.5-8.0)

    b. Evaluate the effect of different ionic strengths (50-200 mM NaCl)

    c. Optimize reducing agent concentrations (0-5 mM DTT or β-mercaptoethanol)

    d. Assess temperature dependence of activity (15-37°C)

  • Systematic variation analysis:

    a. Create a design of experiments (DOE) matrix to systematically evaluate multiple parameters

    b. Identify critical factors affecting activity using factorial design approaches

    c. Develop a robust assay protocol based on identified optimal conditions

  • Standardization implementation:

    a. Establish internal controls for normalization across experiments

    b. Create detailed protocols with specified acceptable ranges for critical parameters

    c. Implement quality control checkpoints throughout the experimental workflow

By systematically addressing these factors, researchers can identify the sources of variability and develop standardized protocols that yield consistent and reproducible activity measurements. Documentation of troubleshooting steps and outcomes is essential for building a knowledge base that benefits the broader research community 4.

How can researchers effectively compare their cybasc3 results with published literature given methodological differences?

Comparing research findings with published literature is challenging due to methodological variations. A structured approach to meaningful comparison includes:

When publishing results, include a comparative discussion section that explicitly addresses methodological differences and their potential impact on findings. This approach not only contextualizes your research within the existing literature but also contributes to standardization efforts in the field 4.

What emerging technologies show promise for advancing cybasc3 research?

Several cutting-edge technologies offer significant potential for advancing our understanding of cybasc3 structure, function, and biological roles:

  • Cryo-electron microscopy (Cryo-EM):

    a. High-resolution structural determination of membrane-embedded cybasc3

    b. Visualization of conformational changes during electron transfer

    c. Structural analysis of cybasc3 complexes with interaction partners

  • Single-molecule techniques:

    a. FRET-based approaches to monitor real-time conformational dynamics

    b. Patch-clamp fluorometry to correlate structural changes with function

    c. Single-molecule force spectroscopy to measure protein stability and unfolding pathways

  • Advanced genome editing:

    a. Prime editing for precise genetic modifications without double-strand breaks

    b. Base editing for introducing specific point mutations in cybasc3

    c. Inducible CRISPR systems for temporal control of gene expression

  • Integrative multi-omics:

    a. Combining transcriptomics, proteomics, and metabolomics data for system-level understanding

    b. Spatial transcriptomics and proteomics to map cybasc3 expression in tissue contexts

    c. Single-cell multi-omics to reveal cell-type specific functions

  • Advanced computational methods:

    a. AlphaFold2 and RoseTTAFold for improved structural predictions

    b. Quantum mechanics/molecular mechanics (QM/MM) simulations for electron transfer mechanisms

    c. Network-based approaches to integrate cybasc3 into cellular pathways

Researchers should consider collaborative approaches that leverage these technologies to address fundamental questions about cybasc3 biology. Interdisciplinary teams combining expertise in structural biology, computational modeling, and zebrafish genetics are particularly well-positioned to make significant advances in this field .

What are the most promising applications of cybasc3 research in disease modeling?

Cytochrome b ascorbate-dependent protein 3 research has emerging applications in modeling various disease states, particularly those involving redox homeostasis. Promising research directions include:

  • Neurodegenerative disease models:

    a. Investigate cybasc3 roles in maintaining neuronal redox balance

    b. Develop zebrafish models with cybasc3 mutations that mimic oxidative stress conditions in Alzheimer's or Parkinson's disease

    c. Test neuroprotective compounds targeting cytochrome-mediated pathways

  • Cardiovascular disease research:

    a. Explore cybasc3 functions in vascular development and homeostasis

    b. Study the impact of cybasc3 dysregulation on endothelial function and atherosclerosis

    c. Investigate potential links between ascorbate metabolism and hypertension

  • Cancer biology applications:

    a. Examine cybasc3 expression patterns in tumor development using zebrafish cancer models

    b. Investigate the protein's role in tumor microenvironment and hypoxia responses

    c. Explore potential connections to cancer cell metabolism and redox adaptations

  • Development of therapeutic strategies:

    a. Screen for compounds that modulate cybasc3 activity as potential therapeutic agents

    b. Investigate gene therapy approaches to correct cybasc3 mutations

    c. Develop targeted drug delivery systems for cybasc3-expressing tissues

Each of these research directions should employ multiple methodological approaches, including in vivo zebrafish models, cell culture systems, and computational predictions. Translational aspects should focus on validating findings across species to assess relevance to human disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.